Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T56365
|
||||
| Former ID |
TTDC00135
|
||||
| Target Name |
B-lymphocyte antigen CD19
|
||||
| Gene Name |
CD19
|
||||
| Synonyms |
B-lymphocyte surface antigen B4; Differentiation antigen CD19; Leu-12; CD19
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0] | |||||
| B-cell lymphoma [ICD9: 202.8; ICD10: C85.1] | |||||
| Chronic lymphocytic leukaemia [ICD10: C91] | |||||
| Diffuse large B-cell lymphoma [ICD9: 200; ICD10: C83.3] | |||||
| Hematologic malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Lymphoma; Chronic lymphocytic leukemia; Multiple myeloma [ICD9: 202.8, 203.0, 204.1, 208.9; ICD10: C81-C86, C90, C91-C95, C91.1] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Non-hodgkin's lymphoma [ICD10: C85] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Scleroderma [ICD9: 701.0710.1; ICD10: L94.0-L94.1, M34] | |||||
| Function |
Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
|
||||
| BioChemical Class |
Immunoglobulin
|
||||
| Target Validation |
T56365
|
||||
| UniProt ID | |||||
| Sequence |
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP DPAWGGGGRMGTWSTR |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Blinatumomab | Drug Info | Approved | Acute lymphoblastic leukemia | [889388], [889412] |
| CTL019 | Drug Info | Phase 2 | Chronic lymphocytic leukaemia | [525190] | |
| JCAR015 | Drug Info | Phase 2 | B-cell lymphoma | [525305] | |
| MDX-1342 | Drug Info | Phase 2 | Leukemia | [524501] | |
| MOR-208 | Drug Info | Phase 2 | Autoimmune diabetes | [524052] | |
| SAR-3419 | Drug Info | Phase 2 | Non-hodgkin's lymphoma | [532514] | |
| Xmab 5871 | Drug Info | Phase 2 | Autoimmune diabetes | [549317] | |
| JCAR014 | Drug Info | Phase 1/2 | Non-hodgkin's lymphoma | [549571] | |
| JCAR017 | Drug Info | Phase 1/2 | Leukemia | [549572] | |
| KTE-C19 CAR | Drug Info | Phase 1/2 | Diffuse large B-cell lymphoma | [549522] | |
| Xmab5871 | Drug Info | Phase 1/2 | Rheumatoid arthritis | [889425] | |
| AFM11 | Drug Info | Phase 1 | Non-hodgkin's lymphoma | [524703] | |
| Combotox | Drug Info | Phase 1 | Leukemia | [548715] | |
| MEDI-551 | Drug Info | Phase 1 | Lymphoma; Chronic lymphocytic leukemia; Multiple myeloma | [542906], [551134] | |
| MEDl-551 | Drug Info | Phase 1 | Scleroderma | [531971] | |
| SGN-19A | Drug Info | Preclinical | Hematologic malignancies | [551669] | |
| Modulator | AFM11 | Drug Info | [889442] | ||
| Anti-CD22/CD19 mab-toxin conjugate | Drug Info | [525761] | |||
| Blinatumomab | Drug Info | [533123] | |||
| Combotox | Drug Info | ||||
| CTL019 | Drug Info | [551967] | |||
| JCAR014 | Drug Info | [551860] | |||
| JCAR015 | Drug Info | [551860] | |||
| JCAR017 | Drug Info | [551860] | |||
| Xmab 5871 | Drug Info | ||||
| Xmab5871 | Drug Info | [889442] | |||
| Inhibitor | KTE-C19 CAR | Drug Info | [549913] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | PI3K-Akt signaling pathway | ||||
| Hematopoietic cell lineage | |||||
| B cell receptor signaling pathway | |||||
| Epstein-Barr virus infection | |||||
| Primary immunodeficiency | |||||
| NetPath Pathway | IL-7 Signaling Pathway | ||||
| PANTHER Pathway | B cell activation | ||||
| Pathway Interaction Database | BCR signaling pathway | ||||
| Reactome | PIP3 activates AKT signaling | ||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| Constitutive Signaling by Aberrant PI3K in Cancer | |||||
| Antigen activates B Cell Receptor (BCR) leading to generation of second messengers | |||||
| WikiPathways | Human Complement System | ||||
| Signaling by the B Cell Receptor (BCR) | |||||
| PIP3 activates AKT signaling | |||||
| B Cell Receptor Signaling Pathway | |||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| References | |||||
| Ref 524052 | ClinicalTrials.gov (NCT01685008) Study of Fc-Optimized Anti-CD19 Antibody (MOR00208) to Treat Non-Hodgkin?? Lymphoma (NHL). U.S. National Institutes of Health. | ||||
| Ref 524501 | ClinicalTrials.gov (NCT01974479) Pilot Study of Redirected Haploidentical Natural Killer Cell Infusions for B-Lineage Acute Lymphoblastic Leukemia. U.S. National Institutes of Health. | ||||
| Ref 524703 | ClinicalTrials.gov (NCT02106091) Safety Study to Assess AFM11 in Patients With Relapsed and/or Refractory CD19 Positive B-cell NHL or B-precursor ALL. U.S. National Institutes of Health. | ||||
| Ref 525190 | ClinicalTrials.gov (NCT02445248) Study of Efficacy and Safety of CTL019 in Adult DLBCL Patients. U.S. National Institutes of Health. | ||||
| Ref 525305 | ClinicalTrials.gov (NCT02535364) Study Evaluating the Efficacy and Safety of JCAR015 in Adult B-cell Acute Lymphoblastic Leukemia (B-ALL). | ||||
| Ref 532514 | A dose-escalation study of SAR3419, an anti-CD19 antibody maytansinoid conjugate, administered by intravenous infusion once weekly in patients with relapsed/refractory B-cell non-Hodgkin lymphoma. Clin Cancer Res. 2014 Jan 1;20(1):213-20. | ||||
| Ref 542906 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7992). | ||||
| Ref 548715 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027936) | ||||
| Ref 549317 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035125) | ||||
| Ref 549522 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800039436) | ||||
| Ref 549571 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041075) | ||||
| Ref 549572 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041076) | ||||
| Ref 889388 | ClinicalTrials.gov (NCT02013167) Blinatumomab Versus Standard of Care Chemotherapy in Patients With Relapsed or Refractory Acute Lymphoblastic Leukemia (ALL) | ||||
| Ref 525761 | Immunotoxins against CD19 and CD22 are effective in killing precursor-B acute lymphoblastic leukemia cells in vitro. Leukemia. 2000 May;14(5):853-8. | ||||
| Ref 530298 | A nonfucosylated human antibody to CD19 with potent B-cell depletive activity for therapy of B-cell malignancies. Cancer Immunol Immunother. 2010 Feb;59(2):257-65. | ||||
| Ref 532514 | A dose-escalation study of SAR3419, an anti-CD19 antibody maytansinoid conjugate, administered by intravenous infusion once weekly in patients with relapsed/refractory B-cell non-Hodgkin lymphoma. Clin Cancer Res. 2014 Jan 1;20(1):213-20. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

