Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T73215
|
||||
| Former ID |
TTDS00268
|
||||
| Target Name |
B-lymphocyte antigen CD20
|
||||
| Gene Name |
MS4A1
|
||||
| Synonyms |
B-lymphocyte surface antigen B1; Bp35; CD20; Leu-16; MS4A1
|
||||
| Target Type |
Successful
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | |||||
| B-cell lymphoma [ICD9: 202.8; ICD10: C85.1] | |||||
| Chronic lymphocytic leukaemia [ICD10: C91] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Cluster headache [ICD10: G44.0] | |||||
| Chronic lymphocytic leukaemia; Non-hodgkin's lymphoma; Systemic lupus erythematosus [ICD9:710; ICD10: C91, C85, M32] | |||||
| Diffuse large B-cell lymphoma; Multiple sclerosis [ICD9: 202.8, 340; ICD10: C85.1, G35] | |||||
| Hematologic malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
| Lymphoma; Non-hodgkin's lymphoma [ICD9: 200, 202, 202.8; ICD10: C81-C86, C82-C85] | |||||
| Late-stage follicular lymphoma [ICD9: 202.0, 202.8; ICD10: C81-C86, C82] | |||||
| Mantle cell lymphoma [ICD9: 200.4, 202.8, 203.0, 208.9; ICD10: C81-C86, C85.7, C90.0, C91-C95] | |||||
| Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
| Multiple sclerosis; Primary progressive [ICD9: 340; ICD10: G35] | |||||
| Multiple scierosis; Rheumatoid arthritis [ICD9:340, 710-719, 714; ICD10: G35, M05-M06] | |||||
| Non-hodgkin's lymphoma [ICD10: C85] | |||||
| Non-hodgkin's lymphoma; Follicular lymphoma [ICD9: 200, 202, 202.0, 202.8; ICD10: C81-C86, C82, C82-C85] | |||||
| Pemphigus disease [ICD9: 694.4; ICD10: L10] | |||||
| Relapsing or primary progressive forms of multiple sclerosis [ICD10: G35] | |||||
| Rheumatold arthritis; Follicular lymphoma [ICD9: 202.0, 714; ICD10: C82, M05-M06] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
This protein may be involved in the regulation of B-cell activation and proliferation.
|
||||
| BioChemical Class |
CD20 ca(2+) channel
|
||||
| Target Validation |
T73215
|
||||
| UniProt ID | |||||
| Sequence |
MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG
LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ibritumomab | Drug Info | Approved | Non-hodgkin's lymphoma | [536361] |
| Obinutuzumab | Drug Info | Approved | Chronic lymphocytic leukaemia | [532651], [541982] | |
| Ocrelizumab | Drug Info | Approved | Relapsing or primary progressive forms of multiple sclerosis | [889446] | |
| Ofatumumab | Drug Info | Approved | Chronic lymphocytic leukaemia | [530677], [541858] | |
| Rituxan Hemotalogy/oncology | Drug Info | Approved | Non-hodgkin's lymphoma | [544126] | |
| Rituximab | Drug Info | Approved | Non-hodgkin's lymphoma | [536940], [541860] | |
| Tositumomab | Drug Info | Approved | Non-hodgkin's lymphoma | [536361], [541861] | |
| Bevacizumab + Rituximab | Drug Info | Phase 3 | Lymphoma; Non-hodgkin's lymphoma | [522045] | |
| MK-8808 | Drug Info | Phase 3 | Late-stage follicular lymphoma | [549266] | |
| Ofatumumab | Drug Info | Phase 3 | Diffuse large B-cell lymphoma; Multiple sclerosis | [530677], [541858] | |
| PF-05280586 | Drug Info | Phase 3 | Cluster headache | [524870] | |
| Rituxan Immunology | Drug Info | Phase 3 | Pemphigus disease | [525110] | |
| AME-133v | Drug Info | Phase 2 | Non-hodgkin's lymphoma | [521860], [549678] | |
| ATM AVI | Drug Info | Phase 2 | Bacterial infections | [549453] | |
| Ibritumomab | Drug Info | Phase 2 | Mantle cell lymphoma | [526641], [541857] | |
| Iodine-131-tositumomab | Drug Info | Phase 2 | Discovery agent | [523216] | |
| Ofatumumab | Drug Info | Phase 2 | Rheumatold arthritis; Follicular lymphoma | [530677], [541858] | |
| SBI-087 | Drug Info | Phase 2 | Multiple scierosis; Rheumatoid arthritis | [522841] | |
| TRU-015 | Drug Info | Phase 2 | Lymphoma | [522257] | |
| Ublituximab | Drug Info | Phase 2 | Chronic lymphocytic leukaemia | [549929] | |
| Veltuzumab | Drug Info | Phase 2 | Chronic lymphocytic leukaemia; Non-hodgkin's lymphoma; Systemic lupus erythematosus | [523540], [543023] | |
| DI-Leu16-IL2 | Drug Info | Phase 1/2 | B-cell lymphoma | [524320] | |
| FBT-A05 | Drug Info | Phase 1/2 | Chronic lymphocytic leukaemia | [548949] | |
| BM-ca | Drug Info | Phase 1 | Non-hodgkin's lymphoma | [549211] | |
| CD20Bi aATC | Drug Info | Phase 1 | Non-hodgkin's lymphoma | [544343] | |
| Iboctadekin + rituximab | Drug Info | Phase 1 | Non-hodgkin's lymphoma; Follicular lymphoma | [549706] | |
| MK-8808 | Drug Info | Phase 1 | Rheumatoid arthritis | [549266] | |
| Rituximab | Drug Info | Phase 1 | Hematologic malignancies | [536940], [541860] | |
| Modulator | 2LM20-4 | Drug Info | [543668] | ||
| Anti-CD20 engineered toxin bodies | Drug Info | [543668] | |||
| ATM AVI | Drug Info | [543668] | |||
| CD20Bi aATC | Drug Info | [544343] | |||
| DI-Leu16-IL2 | Drug Info | [550428] | |||
| DXL-625 | Drug Info | [543668] | |||
| MEDI-552 | Drug Info | ||||
| Veltuzumab | Drug Info | [530047] | |||
| Inhibitor | Anti-CD-20 mab | Drug Info | [543668] | ||
| SBI-087 | Drug Info | [544091] | |||
| Agonist | MK-8808 | Drug Info | [526862] | ||
| Antagonist | PF-05280586 | Drug Info | [532698] | ||
| TRU-015 | Drug Info | [544418] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Hematopoietic cell lineage | ||||
| References | |||||
| Ref 521860 | ClinicalTrials.gov (NCT00354926) Safety and Efficacy Study of an Anti-CD20 Monoclonal Antibody (AME-133v) to Treat Non-Hodgkin's Lymphoma. U.S. National Institutes of Health. | ||||
| Ref 522045 | ClinicalTrials.gov (NCT00486759) A Study of Bevacizumab (Avastin) in Combination With Rituximab (MabThera) and CHOP (Cyclophosphamide, Hydroxydaunorubicin [Doxorubicin], Oncovin [Vincristine], Prednisone) Chemotherapy in Patients With Diffuse Large B-cell Lymphoma. U.S. National Institutes of Health. | ||||
| Ref 522257 | ClinicalTrials.gov (NCT00634933) Study Evaluating 2 Dosing Regimens Of TRU-015 In Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
| Ref 522841 | ClinicalTrials.gov (NCT01008852) Study Evaluating The Efficacy And Safety Of SBI-087 In Seropositive Subjects With Active Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
| Ref 523216 | ClinicalTrials.gov (NCT01224821) Dosimetry/Validation Study of 131Iodine-Anti B1 (Murine) Radioimmunotherapy for Chemotherapy Refractory Low Grade B Cell Lymphomas and Low Grade Lymphomas That Have Transformed to Higher Grade Histologies. U.S. National Institutes of Health. | ||||
| Ref 523540 | ClinicalTrials.gov (NCT01390545) VELVET, a Dose Range Finding Trial of Veltuzumab in Subjects With Moderate to Severe Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
| Ref 524320 | ClinicalTrials.gov (NCT01874288) Phase I/II Study of De-immunized DI-Leu16-IL2 Immunocytokine Administered Subcutaneously in Patients With B-cell NHL. U.S. National Institutes of Health. | ||||
| Ref 524870 | ClinicalTrials.gov (NCT02213263) A Study Of PF-05280586 (Rituximab-Pfizer) Or MabThera (Rituximab-EU) For The First-Line Treatment Of Patients With CD20-Positive, Low Tumor Burden, Follicular Lymphoma (REFLECTIONS B328-06). U.S. National Institutes of Health. | ||||
| Ref 525110 | ClinicalTrials.gov (NCT02383589) A Randomized, Double-Blind Study to Evaluate the Efficacy and Safety of Rituximab Versus MMF in Patients With Pemphigus Vulgaris. U.S. National Institutes of Health. | ||||
| Ref 526641 | Radiation dosimetry results from a Phase II trial of ibritumomab tiuxetan (Zevalin) radioimmunotherapy for patients with non-Hodgkin's lymphoma and mild thrombocytopenia. Cancer Biother Radiopharm. 2003 Apr;18(2):165-78. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536940 | Disease-modifying agents for multiple sclerosis: recent advances and future prospects. Drugs. 2008;68(17):2445-68. doi: 10.2165/0003495-200868170-00004. | ||||
| Ref 541857 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6777). | ||||
| Ref 541858 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6778). | ||||
| Ref 541860 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6780). | ||||
| Ref 541861 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6781). | ||||
| Ref 541982 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6941). | ||||
| Ref 543023 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8268). | ||||
| Ref 544126 | Impact of Rituximab (Rituxan) on the Treatment of B-Cell Non-Hodgkin's Lymphoma. P T. 2010 March; 35(3): 148-157. | ||||
| Ref 544343 | CD20-Targeted T Cells after Stem Cell Transplantation for High Risk and Refractory Non-Hodgkin's Lymphoma. Biol Blood Marrow Transplant. 2013 June; 19(6): 925-933. | ||||
| Ref 548949 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030721) | ||||
| Ref 549211 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033790) | ||||
| Ref 549266 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034367) | ||||
| Ref 526862 | Rituximab (monoclonal anti-CD20 antibody): mechanisms of action and resistance. Oncogene. 2003 Oct 20;22(47):7359-68. | ||||
| Ref 530047 | Veltuzumab, an anti-CD20 mAb for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and immune thrombocytopenic purpura. Curr Opin Mol Ther. 2009 Apr;11(2):200-7. | ||||
| Ref 531291 | BM-ca is a newly defined type I/II anti-CD20 monoclonal antibody with unique biological properties. Int J Oncol. 2011 Feb;38(2):335-44. | ||||
| Ref 531756 | Results of a phase 1 study of AME-133v (LY2469298), an Fc-engineered humanized monoclonal anti-CD20 antibody, in FcgammaRIIIa-genotyped patients with previously treated follicular lymphoma. Clin Cancer Res. 2012 Mar 1;18(5):1395-403. | ||||
| Ref 532416 | Immunotherapy with FBTA05 (Bi20), a trifunctional bispecific anti-CD3 x anti-CD20 antibody and donor lymphocyte infusion (DLI) in relapsed or refractory B-cell lymphoma after allogeneic stem cell transplantation: study protocol of an investigator-driven, open-label, non-randomized, uncontrolled, dose-escalating Phase I/II-trial. J Transl Med. 2013 Jul 2;11:160. | ||||
| Ref 532698 | Comparative nonclinical assessments of the proposed biosimilar PF-05280586 and rituximab (MabThera?). Toxicol Pathol. 2014 Oct;42(7):1069-81. | ||||
| Ref 533097 | The optimized anti-CD20 monoclonal antibody ublituximab bypasses natural killer phenotypic features in Waldenstr?m macroglobulinemia. Haematologica. 2015 Apr;100(4):e147-51. | ||||
| Ref 535062 | A phase I/II trial of iodine-131-tositumomab (anti-CD20), etoposide, cyclophosphamide, and autologous stem cell transplantation for relapsed B-cell lymphomas. Blood. 2000 Nov 1;96(9):2934-42. | ||||
| Ref 535660 | Knockouts model the 100 best-selling drugs--will they model the next 100? Nat Rev Drug Discov. 2003 Jan;2(1):38-51. | ||||
| Ref 536721 | Rituximab blocks binding of radiolabeled anti-CD20 antibodies (Ab) but not radiolabeled anti-CD45 Ab. Blood. 2008 Aug 1;112(3):830-5. Epub 2008 May 23. | ||||
| Ref 536968 | Contribution of radioimmunotherapy to the treatment of lymphoma. Ann Pharm Fr. 2008 Nov-Dec;66(5-6):300-8. Epub 2008 Nov 8. | ||||
| Ref 537294 | Structure of the Fab fragment of therapeutic antibody Ofatumumab provides insights into the recognition mechanism with CD20. Mol Immunol. 2009 Jul;46(11-12):2419-23. Epub 2009 May 8. | ||||
| Ref 543668 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2628). | ||||
| Ref 544091 | Translational Mini-Review Series on B Cell-Directed Therapies: Recent advances in B cell-directed biological therapies for autoimmune disorders. Clin Exp Immunol. 2009 August; 157(2): 198-208. | ||||
| Ref 544343 | CD20-Targeted T Cells after Stem Cell Transplantation for High Risk and Refractory Non-Hodgkin's Lymphoma. Biol Blood Marrow Transplant. 2013 June; 19(6): 925-933. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

