Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T12475
|
||||
| Former ID |
TTDS00273
|
||||
| Target Name |
Gonadotropin-releasing hormone receptor
|
||||
| Gene Name |
GNRHR
|
||||
| Synonyms |
GnRH receptor; GnRH-R; Gonadotrophin releasing hormone receptor; Hypothalamic gonadotropin-releasing hormone receptor; GNRHR
|
||||
| Target Type |
Successful
|
||||
| Disease | Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0] | ||||
| Advanced prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Controlled ovarian stimulation [ICD9: 183; ICD10: C56] | |||||
| Esophageal cancer [ICD9: 150; ICD10: C15] | |||||
| Endometriosis [ICD9: 617; ICD10: N80] | |||||
| Female infertility [ICD9: 628; ICD10: N97.0] | |||||
| Hypothalamic hypogonadism [ICD9: 257.2; ICD10: E23.0, E28.3, E29.1] | |||||
| Hormone deficiency [ICD10: E00-E90] | |||||
| Ovulation [ICD9: 256; ICD10: E28] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Prostate hyperplasia [ICD10: N40] | |||||
| Prostate disease [ICD10: N42.9] | |||||
| Uterine leiomyoma [ICD9: 218.9; ICD10: D25] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle- stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol- calcium second messenger system. Isoform 2 may act as an inhibitor of GnRH-R signaling.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T12475
|
||||
| UniProt ID | |||||
| Sequence |
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL SDPVNHFFFLFAFLNPCFDPLIYGYFSL |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Abarelix | Drug Info | Approved | Advanced prostate cancer | [536321], [538699] |
| Cetrorelix | Drug Info | Approved | Controlled ovarian stimulation | [536772], [538702] | |
| DEGARELIX | Drug Info | Approved | Prostate cancer | [523763], [540953] | |
| Ganirelix | Drug Info | Approved | Ovulation | [536361], [540526] | |
| Gonadorelin | Drug Info | Approved | Hypothalamic hypogonadism | [467710], [536361] | |
| Leuprorelin acetate | Drug Info | Approved | Prostate cancer | [550527] | |
| Nafarelin | Drug Info | Approved | Endometriosis | [536361], [540540] | |
| Triptoreline | Drug Info | Phase 4 | Prostate cancer | [522253] | |
| AEZS-108 | Drug Info | Phase 3 | Acute lymphoblastic leukemia | [524186] | |
| Elagolix | Drug Info | Phase 3 | Uterine leiomyoma | [523945], [543088] | |
| GnRH | Drug Info | Phase 3 | Female infertility | [551890] | |
| ACYLINE | Drug Info | Phase 2 | Prostate cancer | [524775] | |
| ASP-1707 | Drug Info | Phase 2 | Endometriosis | [524185] | |
| KLH-2109 | Drug Info | Phase 2 | Endometriosis | [523797] | |
| Ozarelix | Drug Info | Phase 2 | Prostate disease | [531030] | |
| TAK-385 | Drug Info | Phase 2 | Endometriosis | [540954], [548740] | |
| PEP-223/CoVaccine HT | Drug Info | Phase 1/2 | Prostate cancer | [522656] | |
| Antide | Drug Info | Discontinued in Phase 2 | Prostate hyperplasia | [540520], [544731] | |
| Gonadimmune | Drug Info | Discontinued in Phase 2 | Prostate cancer | [546282] | |
| TAK-013 | Drug Info | Discontinued in Phase 2 | Uterine leiomyoma | [538696], [547550] | |
| A-75998 | Drug Info | Discontinued in Phase 1 | Hormone deficiency | [545556] | |
| NBI-42902 | Drug Info | Discontinued in Phase 1 | Prostate cancer | [538691], [547161] | |
| Prostate cancer vaccine | Drug Info | Discontinued in Phase 1 | Prostate cancer | [547213] | |
| Ramorelix | Drug Info | Discontinued in Phase 1 | Esophageal cancer | [546504] | |
| D-21775 | Drug Info | Terminated | Cancer | [545437] | |
| D-26344 | Drug Info | Terminated | Cancer | [547135] | |
| Modulator (allosteric modulator) | 5-(N,N-hexamethylene)-amiloride | Drug Info | [529377] | ||
| Antagonist | A-75998 | Drug Info | [533603] | ||
| AEZS-115 | Drug Info | [543648] | |||
| antarelix | Drug Info | [534464] | |||
| Antide | Drug Info | [528803] | |||
| ASP-1707 | Drug Info | [549125] | |||
| Cetrorelix | Drug Info | [536250], [537161] | |||
| CMPD-1 | Drug Info | [526554] | |||
| Elagolix | Drug Info | [533106] | |||
| FD-1 | Drug Info | [529377] | |||
| Ganirelix | Drug Info | [536439] | |||
| IN-3 | Drug Info | [526374] | |||
| LXT-101 | Drug Info | [528301] | |||
| Ramorelix | Drug Info | [534062] | |||
| TAK-385 | Drug Info | [551717] | |||
| [125I]cetrorelix | Drug Info | [525830] | |||
| [3H]NBI-49202 | Drug Info | [528389] | |||
| Modulator | Abarelix | Drug Info | [556264] | ||
| AEZS-108 | Drug Info | [525681] | |||
| D-21775 | Drug Info | [543648] | |||
| detirelix | Drug Info | ||||
| GnRH | Drug Info | [543648] | |||
| Gonadimmune | Drug Info | [526646] | |||
| Org-30850 | Drug Info | ||||
| Ozarelix | Drug Info | [531030] | |||
| Triptoreline | Drug Info | [528589] | |||
| Inhibitor | ACYLINE | Drug Info | [528769] | ||
| AN-207 | Drug Info | [543648] | |||
| AZALINE B | Drug Info | [528769] | |||
| Azaline B derivative | Drug Info | [527564] | |||
| D-26344 | Drug Info | [545436] | |||
| DEGARELIX | Drug Info | [527646] | |||
| LHRH | Drug Info | [534724] | |||
| NBI-42902 | Drug Info | [536933] | |||
| PGlu-His-Trp-Ser-His-D-Tyr-Leu-Arg-Pro-Gly-NH2 | Drug Info | [527975] | |||
| PGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 | Drug Info | [527975] | |||
| T-98475 | Drug Info | [529431] | |||
| TAK-013 | Drug Info | [529431] | |||
| WAY-207024 | Drug Info | [530791] | |||
| [4Aph(CO-(C2H4O)3-C2H4-NH-CO-NH-OCH3)5]degarelix | Drug Info | [528235] | |||
| [4Aph(CO-NH-(C2H4O)2-C2H5)5]degarelix | Drug Info | [528235] | |||
| [4Aph(CO-NH-OCH3)5,D-4Aph(CO-NH-OCH3)6]degarelix | Drug Info | [528235] | |||
| [4Aph(CO-NH-OCH3)5]degarelix | Drug Info | [528235] | |||
| [4Aph(CO-NH-OH)5]degarelix | Drug Info | [528235] | |||
| [D-4Aph(CO-NH-(C2H4O)2-C2H5)6]degarelix | Drug Info | [528235] | |||
| [D-4Aph(CO-NH-OCH3)6]degarelix | Drug Info | [528235] | |||
| [D-4Aph(CO-NH-OH)6]degarelix | Drug Info | [528235] | |||
| [D-Dab(CO-NH-OCH3)3]degarelix | Drug Info | [528235] | |||
| [D-Dab(CO-NH-OH)3]degarelix | Drug Info | [528235] | |||
| [D-Dap(CO-NH-OCH3)3]degarelix | Drug Info | [528235] | |||
| [D-Dap(CO-NH-OH)3]degarelix | Drug Info | [528235] | |||
| [D-Gln3,D-Ncy(isopropyl)7]acyline | Drug Info | [528769] | |||
| [D-Gln3,D-Ncy(SO,isopropyl)7]acyline | Drug Info | [528769] | |||
| [D-Gln3,D-Ncy(SO2,isopropyl)7]acyline | Drug Info | [528769] | |||
| [D-Gln3,Ncy(isopropyl)7]acyline | Drug Info | [528769] | |||
| [D-Gln3,Ncy(SO,isopropyl)7]acyline | Drug Info | [528769] | |||
| [D-Gln3,Ncy(SO2,isopropyl)7]acyline | Drug Info | [528769] | |||
| [D-Ncy(2-naphthyl)1]acyline | Drug Info | [528769] | |||
| [D-Ncy(isopropyl)7]acyline | Drug Info | [528769] | |||
| [D-Ncy(methyl)10] acyline | Drug Info | [528769] | |||
| [D-Ncy(methyl)4]acyline | Drug Info | [528769] | |||
| [D-Ncy(SO,isopropyl)7]acyline | Drug Info | [528769] | |||
| [D-Ncy(SO,methyl)10]acyline | Drug Info | [528769] | |||
| [D-Ncy(SO,methyl)4]acyline | Drug Info | [528769] | |||
| [Ncy(2-naphthyl)1]acyline | Drug Info | [528769] | |||
| [Ncy(isopropyl)7]acyline | Drug Info | [528769] | |||
| [Ncy(methyl)10]acyline | Drug Info | [528769] | |||
| [Ncy(methyl)4]acyline | Drug Info | [528769] | |||
| [Ncy(SO,isopropyl)7]acyline | Drug Info | [528769] | |||
| [Ncy(SO,methyl)10]acyline | Drug Info | [528769] | |||
| [Ncy(SO,methyl)4]acyline | Drug Info | [528769] | |||
| Agonist | Gonadorelin | Drug Info | [536360] | ||
| KLH-2109 | Drug Info | [550310] | |||
| Leuprorelin acetate | Drug Info | [551717] | |||
| Nafarelin | Drug Info | [537095] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| GnRH signaling pathway | |||||
| NetPath Pathway | IL1 Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | ||||
| Reactome | Hormone ligand-binding receptors | ||||
| G alpha (q) signalling events | |||||
| WikiPathways | Gastrin-CREB signalling pathway via PKC and MAPK | ||||
| Peptide GPCRs | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| GPCRs, Other | |||||
| References | |||||
| Ref 467710 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4391). | ||||
| Ref 522253 | ClinicalTrials.gov (NCT00633347) Use of Antagonist Versus Agonist GnRH in Oocyte Recipient Endometrium Preparation. U.S. National Institutes of Health. | ||||
| Ref 522656 | ClinicalTrials.gov (NCT00895466) Efficacy and Safety Study of the Therapeutic Vaccine PEP223 in Prostate Cancer Patients. U.S. National Institutes of Health. | ||||
| Ref 523763 | ClinicalTrials.gov (NCT01512472) Firmagon (Degarelix) Intermittent Therapy. U.S. National Institutes of Health. | ||||
| Ref 523797 | ClinicalTrials.gov (NCT01533532) A Randomized, Placebo-controlled, Double-blind Study of KLH-2109 in Patients With Endometriosis (2). U.S. National Institutes of Health. | ||||
| Ref 523945 | ClinicalTrials.gov (NCT01620528) A Clinical Study to Evaluate the Safety and Efficacy of Elagolix in Subjects With Moderate to Severe Endometriosis-Associated Pain. U.S. National Institutes of Health. | ||||
| Ref 524185 | ClinicalTrials.gov (NCT01767090) A Study to Assess the Effectiveness and Safety of Different Doses of ASP1707 Compared to Placebo for Endometriosis Associated Pelvic Pain. U.S. National Institutes ofHealth. | ||||
| Ref 524186 | ClinicalTrials.gov (NCT01767155) Study Comparing AEZS-108/ZoptEC (Zoptarelin Doxorubicin in Endometrial Cancer) to Doxorubicin as a Second Line Therapy of Endometrial Cancer. U.S. National Institutesof Health. | ||||
| Ref 524775 | ClinicalTrials.gov (NCT02147964) ITT-5 Mechanisms of Spermatogenesis. U.S. National Institutes of Health. | ||||
| Ref 531030 | Ozarelix, a fourth generation GnRH antagonist, induces apoptosis in hormone refractory androgen receptor negative prostate cancer cells modulating expression and activity of death receptors. Prostate. 2010 Sep 1;70(12):1340-9. | ||||
| Ref 536321 | Abarelix for injectable suspension: first-in-class gonadotropin-releasing hormone antagonist for prostate cancer. Future Oncol. 2006 Dec;2(6):677-96. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536772 | New drugs in development for the treatment of endometriosis. Expert Opin Investig Drugs. 2008 Aug;17(8):1187-202. | ||||
| Ref 538691 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1178). | ||||
| Ref 538696 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1185). | ||||
| Ref 538699 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1188). | ||||
| Ref 538702 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1190). | ||||
| Ref 540520 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3854). | ||||
| Ref 540526 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3877). | ||||
| Ref 540540 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3902). | ||||
| Ref 540953 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5585). | ||||
| Ref 540954 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5586). | ||||
| Ref 543088 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8362). | ||||
| Ref 544731 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000763) | ||||
| Ref 545437 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003256) | ||||
| Ref 545556 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003694) | ||||
| Ref 546282 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007230) | ||||
| Ref 546504 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008630) | ||||
| Ref 547135 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013297) | ||||
| Ref 547161 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013539) | ||||
| Ref 547213 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014087) | ||||
| Ref 547550 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017215) | ||||
| Ref 548740 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028257) | ||||
| Ref 525681 | Stability of cytotoxic luteinizing hormone-releasing hormone conjugate (AN-152) containing doxorubicin 14-O-hemiglutarate in mouse and human serum in vitro: implications for the design of preclinicalstudies. Proc Natl Acad Sci U S A. 2000 Jan 18;97(2):829-34. | ||||
| Ref 525830 | Residues within transmembrane helices 2 and 5 of the human gonadotropin-releasing hormone receptor contribute to agonist and antagonist binding. Mol Endocrinol. 2000 Jul;14(7):1099-115. | ||||
| Ref 526374 | Rescue of hypogonadotropic hypogonadism-causing and manufactured GnRH receptor mutants by a specific protein-folding template: misrouted proteins as a novel disease etiology and therapeutic target. JClin Endocrinol Metab. 2002 Jul;87(7):3255-62. | ||||
| Ref 526554 | Biological characterization of a novel, orally active small molecule gonadotropin-releasing hormone (GnRH) antagonist using castrated and intact rats. J Pharmacol Exp Ther. 2003 May;305(2):688-95. Epub 2003 Jan 24. | ||||
| Ref 526646 | A novel retro-inverso gonadotropin-releasing hormone (GnRH) immunogen elicits antibodies that neutralize the activity of native GnRH. Endocrinology. 2003 Jul;144(7):3262-9. | ||||
| Ref 527564 | Bioorg Med Chem Lett. 2005 Jun 2;15(11):2894-7.Synthesis, in vivo and in vitro biological activity of novel azaline B analogs. | ||||
| Ref 527646 | J Med Chem. 2005 Jul 28;48(15):4851-60.Iterative approach to the discovery of novel degarelix analogues: substitutions at positions 3, 7, and 8. Part II. | ||||
| Ref 527975 | J Med Chem. 2006 Jan 26;49(2):637-47.Overlapping, nonidentical binding sites of different classes of nonpeptide antagonists for the human gonadotropin-releasing hormone receptor. | ||||
| Ref 528235 | J Med Chem. 2006 Jun 15;49(12):3536-43.Novel analogues of degarelix incorporating hydroxy-, methoxy-, and pegylated-urea moieties at positions 3, 5, 6 and the N-terminus. Part III. | ||||
| Ref 528301 | Regul Pept. 2006 Sep 11;136(1-3):122-9. Epub 2006 Jul 10.In vivo characterization of a novel GnRH (gonadotropin-releasing hormone) antagonist, LXT-101, in normal male rats. | ||||
| Ref 528389 | Kinetics of nonpeptide antagonist binding to the human gonadotropin-releasing hormone receptor: Implications for structure-activity relationships and insurmountable antagonism. Biochem Pharmacol. 2006 Sep 28;72(7):838-49. Epub 2006 Aug 22. | ||||
| Ref 528589 | Regulation of GnRH I receptor gene expression by the GnRH agonist triptorelin, estradiol, and progesterone in the gonadotroph-derived cell line alphaT3-1. Endocrine. 2006 Aug;30(1):139-44. | ||||
| Ref 528769 | J Med Chem. 2007 May 3;50(9):2067-77. Epub 2007 Apr 3.Structure-activity relationship studies of gonadotropin-releasing hormone antagonists containing S-aryl/alkyl norcysteines and their oxidized derivatives. | ||||
| Ref 528803 | Antide (Nal-Lys GnRH antagonist) suppression of pituitary-testicular function and sexual behavior in group-living rhesus monkeys. Physiol Behav. 1991 Aug;50(2):429-35. | ||||
| Ref 529377 | Amiloride derivatives and a nonpeptidic antagonist bind at two distinct allosteric sites in the human gonadotropin-releasing hormone receptor. Mol Pharmacol. 2008 Jun;73(6):1808-15. | ||||
| Ref 529431 | J Med Chem. 2008 Jun 26;51(12):3331-48.Non-peptide gonadotropin-releasing hormone receptor antagonists. | ||||
| Ref 530791 | Bioorg Med Chem Lett. 2010 Apr 15;20(8):2512-5. Epub 2010 Mar 3.Synthesis and biological evaluation of piperazinyl heterocyclic antagonists of the gonadotropin releasing hormone (GnRH) receptor. | ||||
| Ref 531030 | Ozarelix, a fourth generation GnRH antagonist, induces apoptosis in hormone refractory androgen receptor negative prostate cancer cells modulating expression and activity of death receptors. Prostate. 2010 Sep 1;70(12):1340-9. | ||||
| Ref 533106 | Elagolix, a novel, orally bioavailable GnRH antagonist under investigation for the treatment of endometriosis-related pain. Womens Health (Lond Engl). 2015 Jan;11(1):19-28. | ||||
| Ref 533603 | Physicochemical properties of A-75998, an antagonist of luteinizing hormone releasing hormone. J Pharm Sci. 1995 Aug;84(8):953-8. | ||||
| Ref 534062 | Effects of the luteinizing-hormone-releasing hormone (LHRH) antagonist ramorelix (hoe013) and the LHRH agonist buserelin on dimethylbenz[]anthracene-induced mammary carcinoma: studies with slow-release formulations. J Cancer Res Clin Oncol. 1993;119(8):457-62. | ||||
| Ref 534464 | Anal Biochem. 1997 Aug 15;251(1):17-23.Characterization of gonadotropin-releasing hormone analogs based on a sensitive cellular luciferase reporter gene assay. | ||||
| Ref 534724 | J Med Chem. 1998 Oct 22;41(22):4190-5.Discovery of a novel, potent, and orally active nonpeptide antagonist of the human luteinizing hormone-releasing hormone (LHRH) receptor. | ||||
| Ref 536250 | Gonadotrophin-releasing hormone antagonists for assisted conception. Cochrane Database Syst Rev. 2006 Jul 19;3:CD001750. | ||||
| Ref 536360 | Use of cognitive behavior therapy for functional hypothalamic amenorrhea. Ann N Y Acad Sci. 2006 Dec;1092:114-29. | ||||
| Ref 536439 | Age attenuates testosterone secretion driven by amplitude-varying pulses of recombinant human luteinizing hormone during acute gonadotrope inhibition in healthy men. J Clin Endocrinol Metab. 2007 Sep;92(9):3626-32. Epub 2007 Jun 19. | ||||
| Ref 536933 | Discovery of sodium R-(+)-4-{2-[5-(2-fluoro-3-methoxyphenyl)-3-(2-fluoro-6-[trifluoromethyl]benzyl)-4-methyl-2,6-dioxo-3,6-dihydro-2H-pyrimidin-1-yl]-1-phenylethylamino}butyrate (elagolix), a potent and orally available nonpeptide antagonist of the human gonadotropin-releasing hormone receptor. J Med Chem. 2008 Dec 11;51(23):7478-85. | ||||
| Ref 537095 | Reversible downregulation of endocrine and germinative testicular function (hormonal castration) in the dog with the GnRH-agonist azagly-nafarelin as a removable implant "Gonazon"; a preclinical trial. Theriogenology. 2009 Apr 15;71(7):1037-45. Epub 2009 Feb 23. | ||||
| Ref 537161 | Gonadotropin releasing hormone analogs induce apoptosis by extrinsic pathway involving p53 phosphorylation in primary cell cultures of human prostatic adenocarcinomas. Prostate. 2009 Jul 1;69(10):1025-33. | ||||
| Ref 543648 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 256). | ||||
| Ref 545436 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003256) | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

