Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T30985
|
||||
| Former ID |
TTDS00087
|
||||
| Target Name |
Histamine H2 receptor
|
||||
| Gene Name |
HRH2
|
||||
| Synonyms |
Gastric receptor I; H2R; Histamine receptor 2; HRH2
|
||||
| Target Type |
Successful
|
||||
| Disease | Acid-reflux disorders [ICD9: 530.81; ICD10: K21] | ||||
| Duodenal ulcers [ICD10: K25-K27] | |||||
| Gastric secretory disorders [ICD9: 536.8; ICD10: K30] | |||||
| Gastroesophageal reflux disease [ICD9: 140-229, 530; ICD10: K21] | |||||
| Gastric ulcer [ICD9: 531; ICD10: K25] | |||||
| Peptic ulcer [ICD9: 531-534; ICD10: K25-K27] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Stomach ulcer [ICD10: K25-K27] | |||||
| Ulcerative colitis [ICD9: 556; ICD10: K51] | |||||
| Function |
The H2 subclass of histamine receptors mediates gastric acid secretion. Also appears to regulate gastrointestinal motility and intestinal secretion. Possible role in regulating cell growth and differentiation. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and, through a separate G protein-dependent mechanism, the phosphoinositide/protein kinase (PKC) signaling pathway (By similarity).
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T30985
|
||||
| UniProt ID | |||||
| Sequence |
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Betazole | Drug Info | Approved | Gastric secretory disorders | [542134], [550718] |
| Cimetidine | Drug Info | Approved | Acid-reflux disorders | [538263], [538744] | |
| Famotidine | Drug Info | Approved | Peptic ulcer | [537645], [542080] | |
| Nizatidine | Drug Info | Approved | Acid-reflux disorders | [538300], [542265] | |
| Ranitidine | Drug Info | Approved | Peptic ulcer | [537645], [538747] | |
| Ebrotidine | Drug Info | Withdrawn from market | Duodenal ulcers | [544797] | |
| KU-1257 | Drug Info | Discontinued in Phase 3 | Duodenal ulcers | [545005] | |
| Osutidine | Drug Info | Discontinued in Phase 3 | Duodenal ulcers | [545064] | |
| Pibutidine | Drug Info | Discontinued in Phase 3 | Ulcerative colitis | [544697] | |
| IGN-2098 | Drug Info | Discontinued in Phase 2 | Duodenal ulcers | [544900] | |
| Lavoltidine | Drug Info | Discontinued in Phase 2 | Gastroesophageal reflux disease | [544542] | |
| CP-66948 | Drug Info | Discontinued in Phase 1 | Gastric ulcer | [544795] | |
| TRM-115 | Drug Info | Discontinued in Phase 1 | Gastric ulcer | [545104] | |
| Z-300 | Drug Info | Discontinued in Phase 1 | Gastric ulcer | [544901] | |
| CP-331 | Drug Info | Terminated | Pain | [544979] | |
| FRG-8701 | Drug Info | Terminated | Stomach ulcer | [530445] | |
| Inhibitor | (+/-)-nantenine | Drug Info | [530558] | ||
| 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
| VUF-10148 | Drug Info | [529387] | |||
| WAY-207024 | Drug Info | [530005] | |||
| Agonist | amthamine | Drug Info | [529861] | ||
| arpromidine | Drug Info | [527955] | |||
| burimamide | Drug Info | [534673] | |||
| Dimaprit | Drug Info | [551871] | |||
| impromidine | Drug Info | [527955] | |||
| oxo-arpromidine | Drug Info | [527955] | |||
| UR-PG146 | Drug Info | [527955] | |||
| Antagonist | Betazole | Drug Info | [537709] | ||
| Cimetidine | Drug Info | [535112], [536343], [538084] | |||
| CP-66948 | Drug Info | [528820], [551871] | |||
| Famotidine | Drug Info | [534993], [535112], [535379], [537690], [538084] | |||
| Gaster | Drug Info | [535660], [537406] | |||
| IGN-2098 | Drug Info | [526772] | |||
| iodoaminopotentidine | Drug Info | [534519] | |||
| KU-1257 | Drug Info | [533888] | |||
| Lavoltidine | Drug Info | [544366] | |||
| Metiamide | Drug Info | [551376] | |||
| Nizatidine | Drug Info | [536916] | |||
| Osutidine | Drug Info | [525983] | |||
| Ranitidine | Drug Info | [535613], [535660], [538084] | |||
| tiotidine | Drug Info | [534519] | |||
| TRM-115 | Drug Info | [545105] | |||
| Z-300 | Drug Info | [526779], [551871] | |||
| [125I]iodoaminopotentidine | Drug Info | [534291] | |||
| [3H]tiotidine | Drug Info | [526674] | |||
| Modulator | CP-331 | Drug Info | [531237] | ||
| Ebrotidine | Drug Info | [534410] | |||
| FRG-8701 | Drug Info | [530445] | |||
| Pibutidine | Drug Info | [533592] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Calcium signaling pathway | ||||
| Neuroactive ligand-receptor interaction | |||||
| Gastric acid secretion | |||||
| PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
| Histamine H2 receptor mediated signaling pathway | |||||
| PathWhiz Pathway | Intracellular Signalling Through Histamine H2 Receptor and Histamine | ||||
| Gastric Acid Production | |||||
| Reactome | Histamine receptors | ||||
| G alpha (s) signalling events | |||||
| WikiPathways | Monoamine GPCRs | ||||
| GPCRs, Class A Rhodopsin-like | |||||
| Secretion of Hydrochloric Acid in Parietal Cells | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 530445 | Effects of FRG-8701 on gastric acid secretion, gastric mucosal lesions by necrotizing agents and experimental gastric or duodenal ulcer in rats. Jpn J Pharmacol. 1990 Nov;54(3):277-85. | ||||
| Ref 537645 | Clinical review of histamine2 receptor antagonists. Arch Intern Med. 1990 Apr;150(4):745-51. | ||||
| Ref 538263 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074151. | ||||
| Ref 538300 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075616. | ||||
| Ref 538744 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1231). | ||||
| Ref 538747 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1234). | ||||
| Ref 542080 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7074). | ||||
| Ref 542134 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7126). | ||||
| Ref 542265 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7248). | ||||
| Ref 544542 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000092) | ||||
| Ref 544697 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000641) | ||||
| Ref 544795 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001137) | ||||
| Ref 544797 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001139) | ||||
| Ref 544900 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001447) | ||||
| Ref 544901 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001448) | ||||
| Ref 544979 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001767) | ||||
| Ref 545005 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001852) | ||||
| Ref 545064 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002012) | ||||
| Ref 525983 | Effects of osutidine (T-593) and its enantiomers on gastric mucosal hemodynamics and mucosal integrity in anesthetized rats. Arzneimittelforschung. 2001 Jan;51(1):46-50. | ||||
| Ref 526674 | Tiotidine, a histamine H2 receptor inverse agonist that binds with high affinity to an inactive G-protein-coupled form of the receptor. Experimental support for the cubic ternary complex model. Mol Pharmacol. 2003 Aug;64(2):512-20. | ||||
| Ref 526772 | Effects of IGN-2098, a new histamine H2-receptor antagonist, on gastric secretion and gastric and duodenal lesions induced in rats. Comparison with roxatidine. Nihon Yakurigaku Zasshi. 1992 Mar;99(3):167-80. | ||||
| Ref 526779 | Effects of a new histamine H2-receptor antagonist, Z-300, on gastric secretion and gastro-duodenal lesions in rats: comparison with roxatidine. Jpn J Pharmacol. 1992 Jul;59(3):275-89. | ||||
| Ref 527955 | Probing ligand-specific histamine H1- and H2-receptor conformations with NG-acylated Imidazolylpropylguanidines. J Pharmacol Exp Ther. 2006 Apr;317(1):139-46. Epub 2006 Jan 4. | ||||
| Ref 528820 | CP-66,948: an antisecretory histamine H2-receptor antagonist with mucosal protective properties. Dig Dis Sci. 1991 Dec;36(12):1721-8. | ||||
| Ref 529387 | J Med Chem. 2008 Apr 24;51(8):2457-67. Epub 2008 Mar 22.Fragment based design of new H4 receptor-ligands with anti-inflammatory properties in vivo. | ||||
| Ref 529861 | N(G)-acylated aminothiazolylpropylguanidines as potent and selective histamine H(2) receptor agonists. ChemMedChem. 2009 Feb;4(2):232-40. | ||||
| Ref 530005 | J Med Chem. 2009 Apr 9;52(7):2148-52.Discovery of 6-({4-[2-(4-tert-butylphenyl)-1H-benzimidazol-4-yl]piperazin-1-yl}methyl)quinoxaline (WAY-207024): an orally active antagonist of the gonadotropin releasing hormone receptor (GnRH-R). | ||||
| Ref 530445 | Effects of FRG-8701 on gastric acid secretion, gastric mucosal lesions by necrotizing agents and experimental gastric or duodenal ulcer in rats. Jpn J Pharmacol. 1990 Nov;54(3):277-85. | ||||
| Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 531237 | Conjugation of chlorin p(6) to histamine enhances its cellular uptake and phototoxicity in oral cancer cells. Cancer Chemother Pharmacol. 2011 Aug;68(2):359-69. | ||||
| Ref 533592 | Comparative pharmacology of epibatidine: a potent agonist for neuronal nicotinic acetylcholine receptors. Mol Pharmacol. 1995 Oct;48(4):774-82. | ||||
| Ref 533888 | Pharmacological profiles of the new histamine H2-receptor antagonist N-ethyl-N'-[3-[3-(piperidinomethyl)phenoxy] propyl] urea. Arzneimittelforschung. 1993 Feb;43(2):129-33. | ||||
| Ref 534291 | G proteins of the Gq family couple the H2 histamine receptor to phospholipase C. Mol Endocrinol. 1996 Dec;10(12):1697-707. | ||||
| Ref 534410 | Histamine H2-receptor antagonist action of ebrotidine. Effects on gastric acid secretion, gastrin levels and NSAID-induced gastrotoxicity in the rat. Arzneimittelforschung. 1997 Apr;47(4A):439-46. | ||||
| Ref 534519 | Heterologous expression of rat epitope-tagged histamine H2 receptors in insect Sf9 cells. Br J Pharmacol. 1997 Nov;122(5):867-74. | ||||
| Ref 534673 | Constitutive activity and structural instability of the wild-type human H2 receptor. J Neurochem. 1998 Aug;71(2):799-807. | ||||
| Ref 534993 | Blastocyst H(2) receptor is the target for uterine histamine in implantation in the mouse. Development. 2000 Jun;127(12):2643-51. | ||||
| Ref 535112 | Histamine H1 and H2 receptor antagonists accelerate skin barrier repair and prevent epidermal hyperplasia induced by barrier disruption in a dry environment. J Invest Dermatol. 2001 Feb;116(2):261-5. | ||||
| Ref 535379 | Analysis of Vancomycin in the Hindlimb Vascular Bed of the Rat. Am J Ther. 1996 Oct;3(10):681-687. | ||||
| Ref 535613 | Hemodynamic significance of histamine synthesis and histamine H1- and H2-receptor gene expression during endotoxemia. Naunyn Schmiedebergs Arch Pharmacol. 2002 Dec;366(6):513-21. Epub 2002 Oct 29. | ||||
| Ref 535660 | Knockouts model the 100 best-selling drugs--will they model the next 100? Nat Rev Drug Discov. 2003 Jan;2(1):38-51. | ||||
| Ref 536343 | Characterization and modulation of antigen-induced effects in isolated rat heart. J Cardiovasc Pharmacol. 1991 Oct;18(4):556-65. | ||||
| Ref 536916 | Does the use of nizatidine, as a pro-kinetic agent, improve gastric emptying in patients post-oesophagectomy? J Gastrointest Surg. 2009 Mar;13(3):432-7. Epub 2008 Nov 1. | ||||
| Ref 537406 | Afferent signalling from the acid-challenged rat stomach is inhibited and gastric acid elimination is enhanced by lafutidine. BMC Gastroenterol. 2009 Jun 2;9:40. | ||||
| Ref 537690 | Pharmacological control of the human gastric histamine H2 receptor by famotidine: comparison with H1, H2 and H3 receptor agonists and antagonists. Eur J Clin Invest. 1989 Feb;19(1):1-10. | ||||
| Ref 537709 | Effect of nizatidine and cimetidine on betazole-stimulated gastric secretion of normal subjects: comparison of effects on acid, water, and pepsin. Am J Gastroenterol. 1988 Jan;83(1):32-6. | ||||
| Ref 538084 | Effect of the H2 histamine receptor antagonist on oxygen metabolism in some morphotic blood elements in patients with ulcer disease. Hepatogastroenterology. 1998 Jan-Feb;45(19):276-80. | ||||
| Ref 544366 | New and Future Drug Development for Gastroesophageal Reflux Disease. J Neurogastroenterol Motil. 2014 January; 20(1): 6-16. | ||||
| Ref 545105 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002138) | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

