Target General Infomation
Target ID
T93627
Former ID
TTDI01920
Target Name
HIV GAG protein
Gene Name
gag
Synonyms
CA; Gag polyprotein; MA; NC; Pr55Gag; p6gag; gag
Target Type
Clinical Trial
Disease Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26]
HIV-1 infection [ICD9: 001-139, 042; ICD10: B20-B24]
Function
p6-gag: Plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1.
UniProt ID
Sequence
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQI
LGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAA
DTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGAT
PQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTT
STLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRF
YKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKA
RVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEG
HQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRSGVETTTPPQKQEPID
KELYPLTSLRSLFGNDPSSQ
Drugs and Mode of Action
Drug(s) Bevirimat Drug Info Phase 2 Human immunodeficiency virus infection [522771]
LIPO-5 Drug Info Phase 2 Human immunodeficiency virus infection [523727]
Ad35-GRIN Drug Info Phase 1/2 Human immunodeficiency virus infection [524697]
Ad35-GRIN/ENV Drug Info Phase 1 Human immunodeficiency virus infection [523741]
RVSVIN HIV-1 gag vaccine Drug Info Phase 1 Human immunodeficiency virus infection [549955]
TBC-M4 Drug Info Phase 1 Human immunodeficiency virus infection [522665]
GSK-732461 Drug Info Discontinued in Phase 2 Human immunodeficiency virus infection [548656]
Gem 92 Drug Info Discontinued in Phase 1 HIV-1 infection [546454]
PA-1050040 Drug Info Discontinued in Phase 1 Human immunodeficiency virus infection [548420]
MPI-461359 Drug Info Terminated Human immunodeficiency virus infection [548769]
Inhibitor Bevirimat Drug Info [532230]
MPI-461359 Drug Info [531993]
PA-1050040 Drug Info [550838]
Modulator Gem 92 Drug Info
Pathways
Reactome Uncoating of the HIV Virion
Budding and maturation of HIV virion
Integration of provirus
Early Phase of HIV Life Cycle
Minus-strand DNA synthesis
Plus-strand DNA synthesis
2-LTR circle formation
Binding and entry of HIV virion
Membrane binding and targetting of GAG proteins
Assembly Of The HIV Virion
Integration of viral DNA into host genomic DNA
Autointegration results in viral DNA circles
APOBEC3G mediated resistance to HIV-1 infection
Vpr-mediated nuclear import of PICs
WikiPathways Host Interactions of HIV factors
HIV Life Cycle
References
Ref 522665ClinicalTrials.gov (NCT00902824) Safety and Immunogenicity of TBC-M4, a MVA HIV Vaccine Alone or in a Prime-Boost Regimen With ADVAX DNA HIV Vaccine. U.S. National Institutes of Health.
Ref 522771ClinicalTrials.gov (NCT00967187) Safety and Efficacy Study of MPC-4326 for Treatment of Patients With HIV-1 Infection.. U.S. National Institutes of Health.
Ref 523727ClinicalTrials.gov (NCT01492985) Lipopeptide Immunisation With GTU-multiHIV Trial. U.S. National Institutes of Health.
Ref 523741ClinicalTrials.gov (NCT01496989) Safety and Immunogenicity Study of HIV-MAG Vaccine +/- IL-12 and Ad35-GRIN/ENV in HIV-uninfected Volunteers. U.S. National Institutes of Health.
Ref 524697ClinicalTrials.gov (NCT02099994) Safety & Immunogenicity of HIV Vaccines in Healthy Kenyan Adults. U.S. National Institutes of Health.
Ref 546454Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008217)
Ref 548420Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025464)
Ref 548656Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027409)
Ref 548769Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028566)
Ref 549955Attenuation of Recombinant Vesicular Stomatitis Virus-Human Immunodeficiency Virus Type 1 Vaccine Vectors by Gene Translocations and G Gene Truncation Reduces Neurovirulence and Enhances Immunogenicity in Mice. J. Virol. January 2008 vol. 82 no. 1 207-219.
Ref 530544A Phase 1 study to evaluate the safety and immunogenicity of a recombinant HIV type 1 subtype C-modified vaccinia Ankara virus vaccine candidate in Indian volunteers. AIDS Res Hum Retroviruses. 2009 Nov;25(11):1107-16.
Ref 531652Recombinant vesicular stomatitis virus-based vaccines against Ebola and Marburg virus infections. J Infect Dis. 2011 Nov;204 Suppl 3:S1075-81.
Ref 531993Human Immunodeficiency Virus Gag and protease: partners in resistance. Retrovirology. 2012 Aug 6;9:63.
Ref 531994A phase I double blind, placebo-controlled, randomized study of a multigenic HIV-1 adenovirus subtype 35 vector vaccine in healthy uninfected adults. PLoS One. 2012;7(8):e41936.
Ref 532230Synthesis and biological evaluation of a new derivative of bevirimat that targets the Gag CA-SP1 cleavage site. Eur J Med Chem. 2013 Apr;62:453-65.
Ref 533201HIV specific responses induced in nonhuman primates with ANRS HIV-Lipo-5 vaccine combined with rMVA-HIV prime or boost immunizations. Vaccine. 2015 May 11;33(20):2354-9.
Ref 549839Preventive technologies, research toward a cure, and immune-based and gene therapies. HIV Treatment Bulletin. 30 June 2013.
Ref 550838US patent application no. 2015,0105,350, Combination therapy comprising tenofovir alafenamide hemifumarate and cobicistat for use in the treatment of viral infections.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.