Target General Infomation
Target ID
T42000
Former ID
TTDS00447
Target Name
Interleukin-1 beta
Gene Name
IL1B
Synonyms
Catabolin; IL-1 beta; IL-1beta; IL1B
Target Type
Successful
Disease Alzheimer disease [ICD9: 331; ICD10: G30]
Arthritis [ICD9: 710-719; ICD10: M00-M25]
Acute gout flare [ICD9: 274; ICD10: M10]
Cardiovascular disorder [ICD10: I00-I99]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Cryopyrin-associated periodic syndromes; Rheumatoid arthritis [ICD9:277.31, 322.2, 339.8, 708.2, 708.8, 714.3, 710-719, 714; ICD10: E85.0, G03.1, G44.8, L50.2, L50.8, M08.9, M05-M06]
Hypercalcemia [ICD9: 275.42; ICD10: E83.5]
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25]
Immune disorder [ICD10: D80-D89]
Motor neurone disease; Amyotropic lateral sclerosis [ICD9: 335.2; ICD10: G12.2]
Opioid-related disorders; Diabetic neuropathy [ICD9: 250, 250.6, 292, 304.0, 305.50, 356.0, 356.8; ICD10: E08-E13, E10.4, E11.4, E13.4, F11, G64, G90.0]
Osteoarthritis [ICD9: 715; ICD10: M15-M19, M47]
Type 2 diabetes [ICD9: 250; ICD10: E11]
Urticaria; Vasculitis [ICD9: 446, 447.6, 708; ICD10: I77.6, I80, L50, L95, M30-M31]
Function
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
BioChemical Class
Cytokine: interleukin
Target Validation
T42000
UniProt ID
Sequence
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
Drugs and Mode of Action
Drug(s) Canakinumab Drug Info Approved Cryopyrin-associated periodic syndromes; Rheumatoid arthritis [530677], [541853]
Gallium nitrate Drug Info Approved Hypercalcemia [550703]
Glucosamine Drug Info Approved Osteoarthritis [467771], [550735]
Rilonacept Drug Info Approved Arthritis [529941], [541871]
Diacerein Drug Info Phase 4 Discovery agent [522329]
Rilonacept Drug Info Phase 3 Acute gout flare [537207], [541871]
XOMA 052 Drug Info Phase 3 Type 2 diabetes [524947]
ABT-981 Drug Info Phase 2 Osteoarthritis [889392], [889410]
Canakinumab Drug Info Phase 2 Urticaria; Vasculitis [530677], [541853]
Ibudilast Drug Info Phase 2 Opioid-related disorders; Diabetic neuropathy [536374], [542420]
LY-2189102 Drug Info Phase 2 Cardiovascular disorder [522731]
CYT-013-IL1bQb Drug Info Phase 1 Inflammatory disease [522699]
TT-301 Drug Info Phase 1 Alzheimer disease [523488]
Celastrol Drug Info Preclinical Motor neurone disease; Amyotropic lateral sclerosis [536447]
CDP-484 Drug Info Discontinued in Phase 1/2 Immune disorder [547485]
Modulator ABT-981 Drug Info [533176]
DVD-Ig Drug Info [543665]
Rilonacept Drug Info [529941]
Inhibitor CDP-484 Drug Info [544084]
Diacerein Drug Info [537112]
Gallium nitrate Drug Info [536132]
Glucosamine Drug Info [537627]
Ibudilast Drug Info [536374]
TT-301 Drug Info [544205]
Suppressor Celastrol Drug Info [536447]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hematopoietic cell lineage
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Alzheimer&#039
s disease
Prion diseases
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Graft-versus-host disease
NetPath Pathway Leptin Signaling Pathway
IL5 Signaling Pathway
IL1 Signaling Pathway
IL2 Signaling Pathway
IL3 Signaling Pathway
TGF_beta_Receptor Signaling Pathway
Wnt Signaling Pathway
TCR Signaling Pathway
TNFalpha Signaling Pathway
Pathway Interaction Database IL27-mediated signaling events
IL12-mediated signaling events
IL1-mediated signaling events
IFN-gamma pathway
IL23-mediated signaling events
Cellular roles of Anthrax toxin
Reactome Interleukin-1 signaling
Interleukin-1 processing
CLEC7A/inflammasome pathway
WikiPathways Toll-like receptor signaling pathway
Monoamine Transport
SIDS Susceptibility Pathways
TCR Signaling Pathway
Type II interferon signaling (IFNG)
Senescence and Autophagy in Cancer
Cytokines and Inflammatory Response
MAPK Signaling Pathway
Myometrial Relaxation and Contraction Pathways
Aryl Hydrocarbon Receptor Pathway
IL1 and megakaryotyces in obesity
Hematopoietic Stem Cell Differentiation
Spinal Cord Injury
Allograft Rejection
Alzheimers Disease
Leptin signaling pathway
IL-1 signaling pathway
Interleukin-1 signaling
Folate Metabolism
Vitamin B12 Metabolism
Selenium Micronutrient Network
Serotonin Transporter Activity
Regulation of toll-like receptor signaling pathway
NOD pathway
References
Ref 467771(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4535).
Ref 522329ClinicalTrials.gov (NCT00685542) Effect of Diacerein on Hand Osteoarthritis. U.S. National Institutes of Health.
Ref 522699ClinicalTrials.gov (NCT00924105) Safety, Tolerability and Pharmacodynamics of CYT013-IL1bQb in Patients With Type 2 Diabetes. U.S. National Institutes of Health.
Ref 522731ClinicalTrials.gov (NCT00942188) A Study of LY2189102 in Patients With Type 2 Diabetes. U.S. National Institutes of Health.
Ref 523488ClinicalTrials.gov (NCT01357421) Effects of TT301 on Cytokine Levels Post Endotoxin Challenge. U.S. National Institutes of Health.
Ref 524947ClinicalTrials.gov (NCT02258867) Efficacy and Safety Study of Gevokizumab to Treat Behcet's Disease Uveitis. U.S. National Institutes of Health.
Ref 5299412008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6.
Ref 530677Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
Ref 536374Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
Ref 536447Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52.
Ref 537207New relief for gout. Nat Biotechnol. 2009 Apr;27(4):309-11.
Ref 541853(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6773).
Ref 541871(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6790).
Ref 542420(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7399).
Ref 547485Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016757)
Ref 550703Drug information of Gallium nitrate, 2008. eduDrugs.
Ref 550735Drug information of Glucosamine, 2008. eduDrugs.
Ref 889392ClinicalTrials.gov (NCT02087904) A Phase 2a Study Evaluating the Safety, Efficacy, and Pharmacodynamic Effects of ABT-981 in Patients With Knee Osteoarthritis
Ref 889410ClinicalTrials.gov (NCT02384538) A Phase 2a Study Evaluating the Safety and Efficacy of ABT-981 in Patients With Erosive Hand Osteoarthritis
Ref 5299412008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6.
Ref 530677Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
Ref 531297Gevokizumab, an anti-IL-1beta mAb for the potential treatment of type 1 and 2 diabetes, rheumatoid arthritis and cardiovascular disease. Curr Opin Mol Ther. 2010 Dec;12(6):755-69.
Ref 532275Double-blind, randomized study evaluating the glycemic and anti-inflammatory effects of subcutaneous LY2189102, a neutralizing IL-1beta antibody, in patients with type 2 diabetes. Diabetes Care. 2013Aug;36(8):2239-46.
Ref 533176Generation and characterization of ABT-981, a dual variable domain immunoglobulin (DVD-Ig(TM)) molecule that specifically and potently neutralizes both IL-1alpha and IL-1beta. MAbs. 2015;7(3):605-19.
Ref 536132Elimination of arthritis pain and inflammation for over 2 years with a single 90 min, topical 14% gallium nitrate treatment: case reports and review of actions of gallium III. Med Hypotheses. 2005;65(6):1136-41. Epub 2005 Aug 24.
Ref 536374Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
Ref 536447Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52.
Ref 536651Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96.
Ref 537112Non-surgical treatment of osteoarthritis of large joints - new aspects. Wien Med Wochenschr. 2009;159(3-4):76-86.
Ref 537627Glucosamine inhibits IL-1beta-mediated IL-8 production in prostate cancer cells by MAPK attenuation. J Cell Biochem. 2009 Jul 22.
Ref 543665(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2623).
Ref 544084Biological targets for therapeutic interventions in COPD: clinical potential. Int J Chron Obstruct Pulmon Dis. 2006 September; 1(3): 321-334.
Ref 544205A Swell in the Armamentarium of Antiepileptic Drug Targets. Epilepsy Curr. 2011 Nov-Dec; 11(6): 172-176.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.