Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T18779
|
||||
| Former ID |
TTDR00730
|
||||
| Target Name |
Mucin 1
|
||||
| Gene Name |
MUC1
|
||||
| Synonyms |
Breast carcinoma-associated antigen DF3; CD227 antigen; Carcinoma-associated mucin; EMA; Episialin; H23AG; MUC-1; PEM; PEMT; PUM; Peanut-reactive urinary mucin; Polymorphic epithelial mucin; Tumor-associated epithelial membraneantigen; Tumor-associated mucin; Tumour-associated antigen mucin 1; MUC1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | ||||
| Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
| Bipolar disorder [ICD9: 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300; ICD10: F31, F40-F42] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | |||||
| Late-stage solid tumors [ICD9: 140-199, 210-229; ICD10: C00-C75, C7A, C7B, D10-D36, D3A] | |||||
| Multiple myeloma [ICD9: 203; ICD10: C90] | |||||
| Non-small cell lung cancer [ICD10: C33-C34] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
May play a role in adhesive functions and in cell-cell interactions, metastasis and signaling. May provide a protective layer on epithelial surfaces. Direct or indirect interaction with actin cytoskeleton.isoform 7 behaves as a receptor.
|
||||
| BioChemical Class |
Transmembrane protein
|
||||
| UniProt ID | |||||
| Sequence |
MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSV
LSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTS APDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTS ASGSASGSASTLVHNGTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHS SVPPLTSSNHSTSPQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQI YKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVS VSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPAR DTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Yttrium (90Y) clivatuzumab tetraxetan | Drug Info | Phase 3 | Pancreatic cancer | [524457], [542962] |
| TG-4010 | Drug Info | Phase 2/3 | Bipolar disorder | [529572] | |
| AS-1402 | Drug Info | Phase 2 | Breast cancer | [530436] | |
| Emepepimut-S | Drug Info | Phase 2 | Non-small cell lung cancer | [522556] | |
| ICO-25 | Drug Info | Phase 2 | Breast cancer | [528859] | |
| MUC1-Poly-ICLC | Drug Info | Phase 2 | Colorectal cancer | [522466] | |
| Pankomab-GEX | Drug Info | Phase 2 | Cancer | [524367] | |
| BrevaRex | Drug Info | Phase 1/2 | Pancreatic cancer | [546767] | |
| GO-203-2c | Drug Info | Phase 1/2 | Late-stage solid tumors | [524854] | |
| ImMucin | Drug Info | Phase 1/2 | Multiple myeloma | [523236] | |
| Anti-MUC1 mab | Drug Info | Phase 1 | Pancreatic cancer | [551561] | |
| G0-203-2c | Drug Info | Phase 1 | Acute myeloid leukemia | [550808] | |
| MUC-1 dendritic cancer vaccine | Drug Info | Phase 1 | Cancer | [549570] | |
| ONT-10 | Drug Info | Phase 1 | Solid tumours | [523839] | |
| SAR-566658 | Drug Info | Phase 1 | Solid tumours | [523101] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| WikiPathways | Hematopoietic Stem Cell Differentiation | ||||
| References | |||||
| Ref 522466 | ClinicalTrials.gov (NCT00773097) Study of the MUC1 Peptide-Poly-ICLC Adjuvant Vaccine in Individuals With Advanced Colorectal Adenoma. U.S. National Institutes of Health. | ||||
| Ref 522556 | ClinicalTrials.gov (NCT00828009) BLP25 Liposome Vaccine and Bevacizumab After Chemotherapy and Radiation Therapy in Treating Patients With Newly Diagnosed Stage IIIA or Stage IIIB Non-Small Cell LungCancer That Cannot Be Removed by Surgery. U.S. National Institutes of Health. | ||||
| Ref 523101 | ClinicalTrials.gov (NCT01156870) First in Man Study of SAR566658 Administered in Patients With CA6-Positive and Refractory Solid Tumor. U.S. National Institutes of Health. | ||||
| Ref 523236 | ClinicalTrials.gov (NCT01232712) A Study to Assess the Safety and Efficacy of MUC1 Peptide Vaccine and hGM-CSF in Patients With MUC1-positive Tumor Malignancies. U.S. National Institutes of Health. | ||||
| Ref 523839 | ClinicalTrials.gov (NCT01556789) Phase 1 Study of ONT-10 in Patients With Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 524367 | ClinicalTrials.gov (NCT01899599) PankoMab-GEX Versus Placebo as Maintenance Therapy in Advanced Ovarian Cancer. U.S. National Institutes of Health. | ||||
| Ref 524457 | ClinicalTrials.gov (NCT01956812) Phase 3 Trial of 90Y-Clivatuzumab Tetraxetan & Gemcitabine vs Placebo & Gemcitabine in Metastatic Pancreatic Cancer. U.S. National Institutes of Health. | ||||
| Ref 524854 | ClinicalTrials.gov (NCT02204085) A Phase I/II Trial of the MUC1 Inhibitor, GO-203-2C in Patients With Relapsed or Refractory Acute Myeloid Leukemia. U.S. National Institutes of Health. | ||||
| Ref 528859 | Atemonate and Imuteran: novel Russian monoclonal antibody-based therapeutic agents. Biotechnol J. 2007 Jul;2(7):863-70. | ||||
| Ref 529572 | A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44. | ||||
| Ref 530436 | Phase I dose escalation pharmacokinetic assessment of intravenous humanized anti-MUC1 antibody AS1402 in patients with advanced breast cancer. Breast Cancer Res. 2009;11(5):R73. | ||||
| Ref 542962 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8087). | ||||
| Ref 546767 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010209) | ||||
| Ref 526269 | Characterization of an anti-MUC1 monoclonal antibody with potential as a cancer vaccine. Hybrid Hybridomics. 2001;20(5-6):313-24. | ||||
| Ref 526513 | The role of epithelial antigens in diagnosis and staging of breast cancer. Arkh Patol. 2002 Nov-Dec;64(6):13-5. | ||||
| Ref 526717 | Dendritic cell vaccine immunotherapy of cancer targeting MUC1 mucin. Int J Mol Med. 2003 Oct;12(4):493-502. | ||||
| Ref 527298 | Phase I trial of a murine antibody to MUC1 in patients with metastatic cancer: evidence for the activation of humoral and cellular antitumor immunity. Ann Oncol. 2004 Dec;15(12):1825-33. | ||||
| Ref 529572 | A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44. | ||||
| Ref 530436 | Phase I dose escalation pharmacokinetic assessment of intravenous humanized anti-MUC1 antibody AS1402 in patients with advanced breast cancer. Breast Cancer Res. 2009;11(5):R73. | ||||
| Ref 531524 | Emepepimut-S for non-small cell lung cancer. Expert Opin Biol Ther. 2011 Aug;11(8):1091-7. | ||||
| Ref 532171 | Staining of MUC1 in ovarian cancer tissues with PankoMab-GEX detecting the tumour-associated epitope, TA-MUC1, as compared to antibodies HMFG-1 and 115D8. Histol Histopathol. 2013 Feb;28(2):239-44. | ||||
| Ref 532411 | Early in vivo signaling profiles in MUC1-specific CD4+ T cells responding to two different MUC1-targeting vaccines in two different microenvironments. Oncoimmunology. 2013 Mar 1;2(3):e23429. | ||||
| Ref 533070 | Phase I/II study exploring ImMucin, a pan-major histocompatibility complex, anti-MUC1 signal peptide vaccine, in multiple myeloma patients. Br J Haematol. 2015 Apr;169(1):44-56. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

