Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T58921
|
||||
| Former ID |
TTDS00338
|
||||
| Target Name |
Peroxisome proliferator activated receptor gamma
|
||||
| Gene Name |
PPARG
|
||||
| Synonyms |
PPAR-gamma; PPARgamma; Transcription factor PPAR gamma receptor; PPARG
|
||||
| Target Type |
Successful
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Alzheimer disease; Type 2 diabetes [ICD9:331, 250; ICD10: G30, E11] | |||||
| Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | |||||
| Drug abuse [ICD9: 303-304; ICD10: F10-F19] | |||||
| Endometriosis [ICD9: 617; ICD10: N80] | |||||
| Gout [ICD9: 274.00274.1274.8274.9; ICD10: M10] | |||||
| Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78] | |||||
| Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
| Lipid metabolism disorder [ICD10: E75-E78] | |||||
| Metabolic disorders [ICD9: 270-279; ICD10: E70-E89] | |||||
| Non-alcoholic fatty liver disease [ICD9: 571.8; ICD10: K76.0] | |||||
| Nicotine dependence [ICD9: 305.1; ICD10: F17] | |||||
| Ocular inflammation [ICD9: 370.33; ICD10: H16.229] | |||||
| Obesity [ICD9: 278; ICD10: E66] | |||||
| Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
| Type 1 diabetes [ICD9: 250; ICD10: E10] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Receptor that bind peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to a promoter element in the gene for acyl-coa oxidase and activates its transcription.
|
||||
| BioChemical Class |
Nuclear hormone receptor
|
||||
| Target Validation |
T58921
|
||||
| UniProt ID | |||||
| Sequence |
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL LQVIKKTETDMSLHPLLQEIYKDLY |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Pioglitazone | Drug Info | Approved | Diabetes | [537022], [539756] |
| Rosiglitazone XR | Drug Info | Approved | Type 2 diabetes | [556264] | |
| Thiazolidinedione | Drug Info | Approved | Alzheimer disease | [526111] | |
| Troglitazone | Drug Info | Approved | Diabetes | [536361], [539755] | |
| Glitazone | Drug Info | Phase 4 | Discovery agent | [522750] | |
| Balaglitazone | Drug Info | Phase 3 | Type 1 diabetes | [522085] | |
| CS-038 | Drug Info | Phase 3 | Type 2 diabetes | [524807] | |
| FARGLITAZAR | Drug Info | Phase 3 | Type 1 diabetes | [539738], [549914] | |
| Imiglitazar | Drug Info | Phase 3 | Type 2 diabetes | [525383], [539741] | |
| Lobeglitazone | Drug Info | Phase 3 | Diabetes | [531686] | |
| MURAGLITAZAR | Drug Info | Phase 3 | Discovery agent | [521615] | |
| Ragaglitazar | Drug Info | Phase 3 | Type 1 diabetes | [526845], [539729] | |
| Rivoglitazone | Drug Info | Phase 3 | Ocular inflammation | [522181] | |
| Rosiglitazone + metformin | Drug Info | Phase 3 | Diabetes | [522062] | |
| Rosiglitazone + simvastatin | Drug Info | Phase 3 | Type 2 diabetes | [550971] | |
| Rosiglitazone XR | Drug Info | Phase 3 | Alzheimer disease | [531124] | |
| TESAGLITAZAR | Drug Info | Phase 3 | Type 1 diabetes | [521734] | |
| ZYH-1 | Drug Info | Phase 3 | Lipid metabolism disorder | [532516] | |
| MBX-102 | Drug Info | Phase 2/3 | Gout | [521855] | |
| FK-614 | Drug Info | Phase 2 | Type 2 diabetes | [527702] | |
| GED-0507-34-Levo | Drug Info | Phase 2 | Inflammatory bowel disease | [549154] | |
| MBX-2044 | Drug Info | Phase 2 | Type 2 diabetes | [530092] | |
| Naveglitazar | Drug Info | Phase 2 | Diabetes | [521566] | |
| Netoglitazone | Drug Info | Phase 2 | Non-alcoholic fatty liver disease | [536649], [539767] | |
| OMS405 | Drug Info | Phase 2 | Nicotine dependence | [549377] | |
| ONO-5129 | Drug Info | Phase 2 | Diabetes | [521841] | |
| Research programme: peroxisome proliferator-activated receptor gamma agonist, Omeros | Drug Info | Phase 2 | Drug abuse | [549866] | |
| T3D-959 | Drug Info | Phase 1/2 | Alzheimer disease | [525327] | |
| CLX-0921 | Drug Info | Phase 1 | Type 2 diabetes | [526686] | |
| DSP-8658 | Drug Info | Phase 1 | Alzheimer disease; Type 2 diabetes | [522909] | |
| Englitazone sodium | Drug Info | Phase 1 | Type 2 diabetes | [526541] | |
| GW-409544 | Drug Info | Phase 1 | Hyperlipidaemia | [531939], [540380] | |
| Oxeglitazar | Drug Info | Phase 1 | Gout | [531047] | |
| MC-3002 | Drug Info | Preclinical | Metabolic disorders | [548000] | |
| AVE-0847 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [547944] | |
| Ciglitazone | Drug Info | Discontinued in Phase 2 | Endometriosis | [539772], [545679] | |
| GSK-677954 | Drug Info | Discontinued in Phase 2 | Non-alcoholic fatty liver disease | [536649] | |
| Indeglitazar | Drug Info | Discontinued in Phase 2 | Type 2 diabetes | [548153] | |
| MK-767 (KRP-297) | Drug Info | Discontinued in Phase 2 | Type 2 diabetes | [546825] | |
| Reglixane | Drug Info | Discontinued in Phase 2 | Diabetes | [546560] | |
| Sodelglitazar | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [547644] | |
| YM-440 | Drug Info | Discontinued in Phase 2 | Type 1 diabetes | [546747] | |
| DS-6930 | Drug Info | Discontinued in Phase 1 | Diabetes | [549405] | |
| E-3030 | Drug Info | Discontinued in Phase 1 | Hyperlipidaemia | [548044] | |
| LY-929 | Drug Info | Discontinued in Phase 1 | Lipid metabolism disorder | [539723], [547284] | |
| AD-5075 | Drug Info | Terminated | Type 2 diabetes | [534222], [539761] | |
| AKP-320 | Drug Info | Terminated | Type 2 diabetes | [548115] | |
| BVT-142 | Drug Info | Terminated | Type 2 diabetes | [527135] | |
| CS-204 | Drug Info | Terminated | Metabolic disorders | [548591] | |
| DARGLITAZONE | Drug Info | Terminated | Diabetes | [545359] | |
| Edaglitazone | Drug Info | Terminated | Type 2 diabetes | [526596] | |
| KRP-297 | Drug Info | Terminated | Hyperlipidaemia | [526192], [539743] | |
| SB-219994 | Drug Info | Terminated | Diabetes | [534550], [539758] | |
| Sipoglitazar | Drug Info | Terminated | Diabetes | [532486] | |
| Rosiglitazone XR | Drug Info | Investigative | Discovery agent | [550963] | |
| Inhibitor | (2S)-2-(4-chlorophenoxy)-3-phenylpropanoic acid | Drug Info | [551374] | ||
| (2S)-2-(4-ethylphenoxy)-3-phenylpropanoic acid | Drug Info | [551374] | |||
| (2S)-2-(biphenyl-4-yloxy)-3-phenylpropanoic acid | Drug Info | [551374] | |||
| (9S,10E,12Z)-9-hydroxyoctadeca-10,12-dienoic acid | Drug Info | [551374] | |||
| (9Z,11E,13S)-13-hydroxyoctadeca-9,11-dienoic acid | Drug Info | [551374] | |||
| 2-chloro-5-nitro-N-phenylbenzamide | Drug Info | [551374] | |||
| 3-(5-methoxy-1H-indol-3-yl)propanoic acid | Drug Info | [551374] | |||
| YM-440 | Drug Info | [528358], [551871] | |||
| Agonist | 15-deoxy-Delta(12, 14)-prostaglandin J(2) | Drug Info | [535698] | ||
| BVT-142 | Drug Info | [527135], [550926] | |||
| Ciglitazone | Drug Info | [536772] | |||
| CLX-0921 | Drug Info | [526686] | |||
| CS-204 | Drug Info | [544056] | |||
| DARGLITAZONE | Drug Info | [544143], [551871] | |||
| DB-900 | Drug Info | [550862] | |||
| Englitazone sodium | Drug Info | [526541], [551871] | |||
| FK-614 | Drug Info | [527702] | |||
| GED-0507-34-Levo | Drug Info | [532345] | |||
| Glitazone | Drug Info | [534997] | |||
| GSK-677954 | Drug Info | [536649] | |||
| GW7845 | Drug Info | [534935] | |||
| Indeglitazar | Drug Info | [529893] | |||
| Lobeglitazone | Drug Info | [531686] | |||
| LY-929 | Drug Info | [550832] | |||
| MBX-102 | Drug Info | [530092] | |||
| MBX-2044 | Drug Info | [530092] | |||
| OMS405 | Drug Info | [550315] | |||
| Pioglitazone | Drug Info | [535579] | |||
| Research programme: peroxisome proliferator-activated receptor gamma agonist, Omeros | Drug Info | [549867] | |||
| Rivoglitazone | Drug Info | [531434] | |||
| Rosiglitazone + metformin | Drug Info | [550963] | |||
| Rosiglitazone + simvastatin | Drug Info | [550963] | |||
| Rosiglitazone XR | Drug Info | [550963] | |||
| SB-219994 | Drug Info | [527157] | |||
| Sodelglitazar | Drug Info | [531487] | |||
| Thiazolidinedione | Drug Info | [535579] | |||
| Troglitazone | Drug Info | [535579], [535660], [535698] | |||
| Modulator | AD-5075 | Drug Info | [534222] | ||
| AKP-320 | Drug Info | [551584] | |||
| AVE-0847 | Drug Info | ||||
| Balaglitazone | Drug Info | ||||
| CS-038 | Drug Info | ||||
| DS-6930 | Drug Info | [549406] | |||
| DSP-8658 | Drug Info | [533254] | |||
| E-3030 | Drug Info | ||||
| Edaglitazone | Drug Info | [526596] | |||
| FARGLITAZAR | Drug Info | ||||
| GW-2331 | Drug Info | ||||
| GW-409544 | Drug Info | [531939] | |||
| Imiglitazar | Drug Info | [527124] | |||
| KRP-297 | Drug Info | [526192] | |||
| MC-3002 | Drug Info | [1572591] | |||
| MK-767 (KRP-297) | Drug Info | [526645] | |||
| MURAGLITAZAR | Drug Info | ||||
| Naveglitazar | Drug Info | [528458] | |||
| Netoglitazone | Drug Info | [552545] | |||
| ONO-5129 | Drug Info | [1572591] | |||
| Oxeglitazar | Drug Info | [531047] | |||
| Ragaglitazar | Drug Info | [526845] | |||
| Reglixane | Drug Info | [1572591] | |||
| Sipoglitazar | Drug Info | [532486] | |||
| T3D-959 | Drug Info | ||||
| TESAGLITAZAR | Drug Info | ||||
| ZY H2 | Drug Info | [1572605] | |||
| ZYH-1 | Drug Info | [532486] | |||
| Binder | PCG1 | Drug Info | [537068] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | PPAR signaling pathway | ||||
| AMPK signaling pathway | |||||
| Osteoclast differentiation | |||||
| Huntington' | |||||
| s disease | |||||
| Pathways in cancer | |||||
| Transcriptional misregulation in cancer | |||||
| Thyroid cancer | |||||
| NetPath Pathway | IL1 Signaling Pathway | ||||
| TGF_beta_Receptor Signaling Pathway | |||||
| Leptin Signaling Pathway | |||||
| PANTHER Pathway | CCKR signaling map ST | ||||
| Pathway Interaction Database | Noncanonical Wnt signaling pathway | ||||
| Calcineurin-regulated NFAT-dependent transcription in lymphocytes | |||||
| Signaling events mediated by HDAC Class I | |||||
| RXR and RAR heterodimerization with other nuclear receptor | |||||
| Regulation of retinoblastoma protein | |||||
| Reactome | PPARA activates gene expression | ||||
| Transcriptional regulation of white adipocyte differentiation | |||||
| Nuclear Receptor transcription pathway | |||||
| WikiPathways | Wnt Signaling Pathway Netpath | ||||
| Nuclear Receptors in Lipid Metabolism and Toxicity | |||||
| Differentiation of white and brown adipocyte | |||||
| Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
| Transcriptional Regulation of White Adipocyte Differentiation | |||||
| Adipogenesis | |||||
| SREBP signalling | |||||
| Nuclear Receptors | |||||
| References | |||||
| Ref 521566 | ClinicalTrials.gov (NCT00065312) An Evaluation of an Oral Antidiabetic Agent for the Treatment of Type 2 Diabetes. U.S. National Institutes of Health. | ||||
| Ref 521615 | ClinicalTrials.gov (NCT00094991) Mechanism of Action and Efficacy of Muraglitazar in Type 2 Diabetes. U.S. National Institutes of Health. | ||||
| Ref 521734 | ClinicalTrials.gov (NCT00229710) GALLEX 9: Safety and Tolerability of Oral Tesaglitazar When Added to Insulin Therapy in Patients With Type 2 Diabetes. U.S. National Institutes of Health. | ||||
| Ref 521841 | ClinicalTrials.gov (NCT00335712) Pilot Study of ONO-5129 in Patients With Type 2 Diabetes Mellitus. U.S. National Institutes of Health. | ||||
| Ref 521855 | ClinicalTrials.gov (NCT00353587) Safety and Efficacy Study of Metaglidasen in Type 2 Diabetes in Patients Suboptimally Controlled on Insulin. U.S. National Institutes of Health. | ||||
| Ref 522062 | ClinicalTrials.gov (NCT00499707) Efficacy and Safety Study of Rosiglitazone/Metformin Therapy vs Rosiglitazone and Metformin in Type 2 Diabetes Subjects. U.S. National Institutes of Health. | ||||
| Ref 522085 | ClinicalTrials.gov (NCT00515632) Efficacy and Safety of Treatment With Balaglitazone in Type 2 Diabetes Patients on Stable Insulin Therapy. U.S. National Institutes of Health. | ||||
| Ref 522181 | ClinicalTrials.gov (NCT00571519) Randomized, Double-blind, Active-controlled, Study of Rivoglitazone in Type 2 Diabetes Mellitus. U.S. National Institutes of Health. | ||||
| Ref 522750 | ClinicalTrials.gov (NCT00953498) Influence of Glitazones on the Vasodilatory Effect of High-density Lipoprotein (HDL) Lipoproteins. U.S. National Institutes of Health. | ||||
| Ref 522909 | ClinicalTrials.gov (NCT01042106) Safety, Pharmacokinetics and Pharmacodynamics of DSP-8658 in Patients With Type 2 Diabetes Mellitus and Healthy Adults. U.S. National Institutes of Health. | ||||
| Ref 524807 | ClinicalTrials.gov (NCT02173457) Study of Chiglitazar Compare With Sitagliptin in Type 2 Diabetes Patients. U.S. National Institutes of Health. | ||||
| Ref 525327 | ClinicalTrials.gov (NCT02560753) Feasibility Study in Subjects With Mild to Moderate Alzheimer's Disease. | ||||
| Ref 525383 | Medicinal Chemistry and Actions of Dual and Pan PPAR Modulators. Open Med Chem J. 2011;5(Suppl 2):93-8. | ||||
| Ref 526111 | Thiazolidinediones: a comparative review of approved uses. Diabetes Technol Ther. 2000 Autumn;2(3):429-40. | ||||
| Ref 526541 | PPARgamma agonists in the treatment of type II diabetes: is increased fatness commensurate with long-term efficacy. Int J Obes Relat Metab Disord. 2003 Feb;27(2):147-61. | ||||
| Ref 526596 | A specific peroxisome proliferator-activated receptor-gamma (PPAR-gamma) ligand, pioglitazone, ameliorates gastric mucosal damage induced by ischemia and reperfusion in rats. Redox Rep. 2002;7(5):343-6. | ||||
| Ref 526686 | A novel peroxisome proliferator-activated gamma (PPAR gamma) agonist, CLX-0921, has potent antihyperglycemic activity with low adipogenic potential. Metabolism. 2003 Aug;52(8):1012-8. | ||||
| Ref 526845 | Ragaglitazar: the pharmacokinetics, pharmacodynamics, and tolerability of a novel dual PPAR alpha and gamma agonist in healthy subjects and patients with type 2 diabetes. J Clin Pharmacol. 2003 Nov;43(11):1244-56. | ||||
| Ref 527135 | A new class of peroxisome proliferator-activated receptor agonists with a novel binding epitope shows antidiabetic effects. J Biol Chem. 2004 Sep 24;279(39):41124-30. Epub 2004 Jul 15. | ||||
| Ref 527702 | FK-614, a selective peroxisome proliferator-activated receptor gamma agonist, improves peripheral glucose utilization while decreasing hepatic insulin extraction in alloxan-induced diabetic dogs. Metabolism. 2005 Sep;54(9):1250-8. | ||||
| Ref 530092 | MBX-102/JNJ39659100, a novel peroxisome proliferator-activated receptor-ligand with weak transactivation activity retains antidiabetic properties in the absence of weight gain and edema. Mol Endocrinol. 2009 Jul;23(7):975-88. | ||||
| Ref 531047 | Therapeutic potential of aleglitazar, a new dual PPAR-alpha/gamma agonist: implications for cardiovascular disease in patients with diabetes mellitus. Am J Cardiovasc Drugs. 2010;10(4):209-16. | ||||
| Ref 531124 | Rosiglitazone monotherapy in mild-to-moderate Alzheimer's disease: results from a randomized, double-blind, placebo-controlled phase III study. Dement Geriatr Cogn Disord. 2010;30(2):131-46. | ||||
| Ref 531686 | Tolerability and pharmacokinetics of lobeglitazone (CKD-501), a peroxisome proliferator-activated receptor-gamma agonist: a single- and multiple-dose, double-blind, randomized control study in healthy male Korean subjects. Clin Ther. 2011 Nov;33(11):1819-30. | ||||
| Ref 531939 | Design novel dual agonists for treating type-2 diabetes by targeting peroxisome proliferator-activated receptors with core hopping approach. PLoS One. 2012;7(6):e38546. | ||||
| Ref 532486 | Pharmacokinetics, safety, and tolerability of saroglitazar (ZYH1), a predominantly PPARalpha agonist with moderate PPARgamma agonist activity in healthy human subjects. Clin Drug Investig. 2013 Nov;33(11):809-16. | ||||
| Ref 532516 | A multicenter, prospective, randomized, double-blind study to evaluate the safety and efficacy of Saroglitazar 2 and 4??g compared with placebo in type 2 diabetes mellitus patients having hypertriglyceridemia not controlled with atorvastatin therapy (PRESS VI). Diabetes Technol Ther. 2014 Feb;16(2):63-71. | ||||
| Ref 534222 | Thiazolidinediones produce a conformational change in peroxisomal proliferator-activated receptor-gamma: binding and activation correlate with antidiabetic actions in db/db mice. Endocrinology. 1996 Oct;137(10):4189-95. | ||||
| Ref 534550 | Identification of high-affinity binding sites for the insulin sensitizer rosiglitazone (BRL-49653) in rodent and human adipocytes using a radioiodinated ligand for peroxisomal proliferator-activated receptor gamma. J Pharmacol Exp Ther. 1998 Feb;284(2):751-9. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536649 | Emerging drugs for non-alcoholic fatty liver disease. Expert Opin Emerg Drugs. 2008 Mar;13(1):145-58. | ||||
| Ref 537022 | Emerging drug candidates of dipeptidyl peptidase IV (DPP IV) inhibitor class for the treatment of Type 2 Diabetes. Curr Drug Targets. 2009 Jan;10(1):71-87. | ||||
| Ref 539723 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2657). | ||||
| Ref 539729 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2664). | ||||
| Ref 539738 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2672). | ||||
| Ref 539741 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2675). | ||||
| Ref 539743 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2677). | ||||
| Ref 539755 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2693). | ||||
| Ref 539756 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2694). | ||||
| Ref 539758 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2698). | ||||
| Ref 539761 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2701). | ||||
| Ref 539767 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2707). | ||||
| Ref 539772 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2711). | ||||
| Ref 540380 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3440). | ||||
| Ref 545359 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003002) | ||||
| Ref 545679 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004145) | ||||
| Ref 546560 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008953) | ||||
| Ref 546747 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010082) | ||||
| Ref 546825 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010490) | ||||
| Ref 547284 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014823) | ||||
| Ref 547644 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018093) | ||||
| Ref 547944 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020608) | ||||
| Ref 548000 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021065) | ||||
| Ref 548044 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021476) | ||||
| Ref 548115 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022081) | ||||
| Ref 548153 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022483) | ||||
| Ref 548591 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026847) | ||||
| Ref 549154 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032997) | ||||
| Ref 549377 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035962) | ||||
| Ref 526541 | PPARgamma agonists in the treatment of type II diabetes: is increased fatness commensurate with long-term efficacy. Int J Obes Relat Metab Disord. 2003 Feb;27(2):147-61. | ||||
| Ref 526596 | A specific peroxisome proliferator-activated receptor-gamma (PPAR-gamma) ligand, pioglitazone, ameliorates gastric mucosal damage induced by ischemia and reperfusion in rats. Redox Rep. 2002;7(5):343-6. | ||||
| Ref 526686 | A novel peroxisome proliferator-activated gamma (PPAR gamma) agonist, CLX-0921, has potent antihyperglycemic activity with low adipogenic potential. Metabolism. 2003 Aug;52(8):1012-8. | ||||
| Ref 526845 | Ragaglitazar: the pharmacokinetics, pharmacodynamics, and tolerability of a novel dual PPAR alpha and gamma agonist in healthy subjects and patients with type 2 diabetes. J Clin Pharmacol. 2003 Nov;43(11):1244-56. | ||||
| Ref 527124 | A novel oxyiminoalkanoic acid derivative, TAK-559, activates human peroxisome proliferator-activated receptor subtypes. Eur J Pharmacol. 2004 Jul 8;495(1):17-26. | ||||
| Ref 527135 | A new class of peroxisome proliferator-activated receptor agonists with a novel binding epitope shows antidiabetic effects. J Biol Chem. 2004 Sep 24;279(39):41124-30. Epub 2004 Jul 15. | ||||
| Ref 527157 | PPAR-gamma agonists as therapy for diseases involving airway neutrophilia. Eur Respir J. 2004 Jul;24(1):18-23. | ||||
| Ref 527702 | FK-614, a selective peroxisome proliferator-activated receptor gamma agonist, improves peripheral glucose utilization while decreasing hepatic insulin extraction in alloxan-induced diabetic dogs. Metabolism. 2005 Sep;54(9):1250-8. | ||||
| Ref 528358 | The novel hypoglycemic agent YM440 improves hepatic insulin resistance in obese Zucker fatty rats. J Pharmacol Sci. 2006 Aug;101(4):311-7. Epub 2006 Aug 5. | ||||
| Ref 528458 | The disposition and metabolism of naveglitazar, a peroxisome proliferator-activated receptor alpha-gamma dual, gamma-dominant agonist in mice, rats, and monkeys. Drug Metab Dispos. 2007 Jan;35(1):51-61. Epub 2006 Sep 29. | ||||
| Ref 529893 | Scaffold-based discovery of indeglitazar, a PPAR pan-active anti-diabetic agent. Proc Natl Acad Sci U S A. 2009 Jan 6;106(1):262-7. | ||||
| Ref 530092 | MBX-102/JNJ39659100, a novel peroxisome proliferator-activated receptor-ligand with weak transactivation activity retains antidiabetic properties in the absence of weight gain and edema. Mol Endocrinol. 2009 Jul;23(7):975-88. | ||||
| Ref 531047 | Therapeutic potential of aleglitazar, a new dual PPAR-alpha/gamma agonist: implications for cardiovascular disease in patients with diabetes mellitus. Am J Cardiovasc Drugs. 2010;10(4):209-16. | ||||
| Ref 531434 | A randomized-controlled trial to investigate the effects of rivoglitazone, a novel PPAR gamma agonist on glucose-lipid control in type 2 diabetes. Diabetes Obes Metab. 2011 Sep;13(9):806-13. | ||||
| Ref 531487 | Docking and molecular dynamics simulations of peroxisome proliferator activated receptors interacting with pan agonist sodelglitazar. Protein Pept Lett. 2011 Oct;18(10):1021-7. | ||||
| Ref 531686 | Tolerability and pharmacokinetics of lobeglitazone (CKD-501), a peroxisome proliferator-activated receptor-gamma agonist: a single- and multiple-dose, double-blind, randomized control study in healthy male Korean subjects. Clin Ther. 2011 Nov;33(11):1819-30. | ||||
| Ref 531939 | Design novel dual agonists for treating type-2 diabetes by targeting peroxisome proliferator-activated receptors with core hopping approach. PLoS One. 2012;7(6):e38546. | ||||
| Ref 532345 | PPAR-gamma in ulcerative colitis: a novel target for intervention. Curr Drug Targets. 2013 Nov;14(12):1501-7. | ||||
| Ref 532486 | Pharmacokinetics, safety, and tolerability of saroglitazar (ZYH1), a predominantly PPARalpha agonist with moderate PPARgamma agonist activity in healthy human subjects. Clin Drug Investig. 2013 Nov;33(11):809-16. | ||||
| Ref 533254 | Effects of DSP-8658, a Novel Selective Peroxisome Proliferator-activated Receptors a/gamma Modulator, on Adipogenesis and Glucose Metabolism in Diabetic Obese Mice. Exp Clin Endocrinol Diabetes. 2015Sep;123(8):492-9. | ||||
| Ref 534222 | Thiazolidinediones produce a conformational change in peroxisomal proliferator-activated receptor-gamma: binding and activation correlate with antidiabetic actions in db/db mice. Endocrinology. 1996 Oct;137(10):4189-95. | ||||
| Ref 534935 | A new ligand for the peroxisome proliferator-activated receptor-gamma (PPAR-gamma), GW7845, inhibits rat mammary carcinogenesis. Cancer Res. 1999 Nov 15;59(22):5671-3. | ||||
| Ref 534997 | Peroxisome proliferator-activated receptor alpha activators improve insulin sensitivity and reduce adiposity. J Biol Chem. 2000 Jun 2;275(22):16638-42. | ||||
| Ref 535579 | Functional PPAR-gamma receptor is a novel therapeutic target for ACTH-secreting pituitary adenomas. Nat Med. 2002 Nov;8(11):1281-7. Epub 2002 Oct 15. | ||||
| Ref 535660 | Knockouts model the 100 best-selling drugs--will they model the next 100? Nat Rev Drug Discov. 2003 Jan;2(1):38-51. | ||||
| Ref 535698 | Expression of peroxisome proliferator-activated receptors (PPARs) in human urinary bladder carcinoma and growth inhibition by its agonists. Int J Cancer. 2003 May 1;104(5):597-602. | ||||
| Ref 536649 | Emerging drugs for non-alcoholic fatty liver disease. Expert Opin Emerg Drugs. 2008 Mar;13(1):145-58. | ||||
| Ref 536772 | New drugs in development for the treatment of endometriosis. Expert Opin Investig Drugs. 2008 Aug;17(8):1187-202. | ||||
| Ref 544056 | Peroxisome Proliferators-Activated Receptor (PPAR) Modulators and Metabolic Disorders. PPAR Res. 2008; 2008: 679137. | ||||
| Ref 544143 | The PPAR-gamma agonist, darglitazone, restores acute inflammatory responses to cerebral hypoxia-ischemia in the diabetic ob/ob mouse. J Cereb Blood Flow Metab. 2010 February; 30(2): 352-360. | ||||
| Ref 549406 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800036558) | ||||
| Ref 550862 | CN patent application no. 102459215, 3-(4-aminophenyl)-2-furancarboxylic acid derivative and pharmaceutically acceptable salt thereof. | ||||
| Ref 551584 | Chronic glucose-lowering effects of rosiglitazone and bis(ethylmaltolato) oxovanadium(IV) in ZDF rats. Canadian Journal of Physiology and Pharmacology. 12/2003; 81(11):1049-55. | ||||
| Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| Ref 552545 | Netoglitazone is a PPAR-gamma ligand with selective effects on bone and fat. Bone. 2006 Jan;38(1):74-84. Epub 2005 Aug 30. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

