Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T76198
|
||||
| Former ID |
TTDS00395
|
||||
| Target Name |
Thromboxane A2 receptor
|
||||
| Gene Name |
TBXA2R
|
||||
| Synonyms |
Prostanoid TP receptor; TXA2 receptor; TXA2-R; TBXA2R
|
||||
| Target Type |
Successful
|
||||
| Disease | Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4] | ||||
| Acute myocardial infarction [ICD9: 410; ICD10: I21-I22] | |||||
| Asthma [ICD10: J45] | |||||
| Allergic asthma [ICD9: 493, 995.3; ICD10: J45, T78.4] | |||||
| Angina pectoris [ICD9: 413; ICD10: I20] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Diabetic neuropathy [ICD9: 250, 250.6, 356.0, 356.8; ICD10: E11.40] | |||||
| Erectile dysfunction [ICD9: 302.72, 607.84; ICD10: F52.2, N48.4] | |||||
| Peripheral vascular disease [ICD9: 443.9; ICD10: I73.9] | |||||
| Perennial allergic rhinitis [ICD9: 204.0, 472.0, 477, 995.3; ICD10: C91.0, J00, J30, J31.0, T78.4] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Thrombosis [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82] | |||||
| Thromboembolism [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Receptor for thromboxane A2 (TXA2), a potentstimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C. Isoform 1 activates adenylyl cyclase. Isoform 2 inhibits adenylyl cyclase.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T76198
|
||||
| UniProt ID | |||||
| Sequence |
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Alprostadil | Drug Info | Approved | Erectile dysfunction | [536500], [539183] |
| Ridogrel | Drug Info | Approved | Acute myocardial infarction | [536491] | |
| LAROPIPRANT | Drug Info | Phase 4 | Discovery agent | [523049], [540312] | |
| Ramatroban | Drug Info | Phase 2/3 | Perennial allergic rhinitis | [521819], [539212] | |
| FK-070 | Drug Info | Phase 2 | Angina pectoris | [534202] | |
| Ifetroban sodium | Drug Info | Phase 2 | Thrombosis | [539284] | |
| KP-496 | Drug Info | Phase 2 | Asthma | [528550] | |
| TAK-128 | Drug Info | Phase 2 | Diabetic neuropathy | [521733] | |
| BIBV 308 | Drug Info | Phase 1 | Peripheral vascular disease | [524888] | |
| DT-TX-30 | Drug Info | Phase 1 | Angina pectoris | [534431] | |
| G-619 | Drug Info | Phase 1 | Thrombosis | [534091] | |
| YM-57158 | Drug Info | Phase 1 | Allergic rhinitis | [534743] | |
| PGF2alpha | Drug Info | Clinical trial | Solid tumours | [532003] | |
| Domitroban | Drug Info | Discontinued in Preregistration | Thrombosis | [539275], [545002] | |
| DALTROBAN | Drug Info | Discontinued in Phase 3 | Discovery agent | [539283], [544557] | |
| Seratrodast | Drug Info | Discontinued in Phase 3 | Allergic asthma | [536361] | |
| Terutroban sodium | Drug Info | Discontinued in Phase 3 | Thromboembolism | [546968] | |
| ICI-192605 | Drug Info | Discontinued in Phase 2 | Thrombosis | [541321], [544641] | |
| Linotroban | Drug Info | Discontinued in Phase 2 | Thrombosis | [545440] | |
| SQ-30741 | Drug Info | Discontinued in Phase 2 | Thrombosis | [544628] | |
| Z-335 | Drug Info | Discontinued in Phase 2 | Thrombosis | [546050] | |
| CGS-22652 | Drug Info | Discontinued in Phase 1 | Angina pectoris | [545054] | |
| KT2-962 | Drug Info | Discontinued in Phase 1 | Thrombosis | [545314] | |
| KW-3635 | Drug Info | Discontinued in Phase 1 | Thrombosis | [539273], [544622] | |
| L-657925 | Drug Info | Terminated | Discovery agent | [544623] | |
| ON-579 | Drug Info | Terminated | Asthma | [545526] | |
| SQ-29548 | Drug Info | Terminated | Discovery agent | [539277], [545003] | |
| SQ-33961 | Drug Info | Terminated | Thromboembolism | [544974] | |
| Sulotroban | Drug Info | Terminated | Asthma | [544519] | |
| UP-116-77 | Drug Info | Terminated | Thromboembolism | [545861] | |
| Vapiprost | Drug Info | Terminated | Cardiovascular disorder | [539272], [544530] | |
| ZT-386 | Drug Info | Terminated | Asthma | [545658] | |
| Agonist | 10,10-difluoro TXA2 | Drug Info | [533342] | ||
| AGN 191976 | Drug Info | [534256] | |||
| AGN192093 | Drug Info | [534256] | |||
| butaprost (free acid form) | Drug Info | [525673] | |||
| carbacyclin | Drug Info | [525673] | |||
| carbocyclic thromboxane A2 | Drug Info | [526825] | |||
| cloprostenol | Drug Info | [525673] | |||
| EP 171 | Drug Info | [533341] | |||
| fluprostenol | Drug Info | [525673] | |||
| I-BOP | Drug Info | [534478] | |||
| M&B 28767 | Drug Info | [525673] | |||
| PGF2alpha | Drug Info | [525673] | |||
| SQ 26655 | Drug Info | [533502] | |||
| STA2 | Drug Info | [534478] | |||
| U46609 | Drug Info | [526825] | |||
| U46619 | Drug Info | [525673] | |||
| [125I]BOP | Drug Info | [532986] | |||
| [3H]U46619 | Drug Info | [525673] | |||
| Antagonist | AH23848 | Drug Info | [525673] | ||
| BIBV 308 | Drug Info | [536029] | |||
| Domitroban | Drug Info | [533694] | |||
| DT-TX-30 | Drug Info | [534431] | |||
| I-SAP | Drug Info | [526809] | |||
| ICI-192605 | Drug Info | [529402] | |||
| Ifetroban sodium | Drug Info | [536029] | |||
| KT2-962 | Drug Info | [534176], [551871] | |||
| KW-3635 | Drug Info | [533825] | |||
| Linotroban | Drug Info | [534495] | |||
| ONO-3708 | Drug Info | [533405] | |||
| ONO-8809 | Drug Info | [529292], [551871] | |||
| Ramatroban | Drug Info | [536488] | |||
| Seratrodast | Drug Info | [535888] | |||
| SQ-30741 | Drug Info | [529394], [551871] | |||
| Terutroban sodium | Drug Info | [528120] | |||
| Z-335 | Drug Info | [526369], [551871] | |||
| [125I]PTA-OH | Drug Info | [533468] | |||
| [125I]SAP | Drug Info | [526809] | |||
| [125I]SQ-29548 | Drug Info | [533391] | |||
| [3H]S-145 | Drug Info | [526796] | |||
| [3H]SQ-29548 | Drug Info | [525673] | |||
| Modulator | Alprostadil | Drug Info | [534906] | ||
| CGS-22652 | Drug Info | ||||
| FK-070 | Drug Info | [534202] | |||
| G-619 | Drug Info | [534091] | |||
| KP-496 | Drug Info | [528550] | |||
| ON-579 | Drug Info | [533593] | |||
| S 18204 | Drug Info | ||||
| SQ-33961 | Drug Info | [551648] | |||
| Sulotroban | Drug Info | [532727] | |||
| TAK-128 | Drug Info | [521733] | |||
| UP-116-77 | Drug Info | [534051] | |||
| Vapiprost | Drug Info | [544028] | |||
| YM-57158 | Drug Info | [534743] | |||
| ZT-386 | Drug Info | [545659] | |||
| Inhibitor | BM-573 | Drug Info | [528239] | ||
| DALTROBAN | Drug Info | [527205] | |||
| L-657925 | Drug Info | [529310] | |||
| LAROPIPRANT | Drug Info | [528672] | |||
| SQ-29548 | Drug Info | [529310] | |||
| U-44069 | Drug Info | [529789] | |||
| Binder | Ridogrel | Drug Info | [537194] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Calcium signaling pathway | ||||
| Neuroactive ligand-receptor interaction | |||||
| Platelet activation | |||||
| Reactome | Prostanoid ligand receptors | ||||
| G alpha (q) signalling events | |||||
| G alpha (12/13) signalling events | |||||
| Thromboxane signalling through TP receptor | |||||
| WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| Small Ligand GPCRs | |||||
| Signal amplification | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 521733 | ClinicalTrials.gov (NCT00229437) Efficacy and Safety Study of TAK-128 in Treating Subjects With Diabetic Peripheral Neuropathy. U.S. National Institutes of Health. | ||||
| Ref 521819 | ClinicalTrials.gov (NCT00311051) Ramatroban/Montelukast Versus Montelukast/Placebo on the Early Allergic Reaction in Asthma Sensitive to House Dust Mite. U.S. National Institutes of Health. | ||||
| Ref 523049 | ClinicalTrials.gov (NCT01126073) Niacin/Laropiprant and Endothelial Function. U.S. National Institutes of Health. | ||||
| Ref 524888 | ClinicalTrials.gov (NCT02223013) Relative Bioavailability and Tolerability of Two New Different Extended Release Capsules of BIBV 308 SE, Versus a Solution of BIBV 308 SE in Healthy Subjects. U.S. National Institutes of Health. | ||||
| Ref 528550 | Effects of KP-496, a novel dual antagonist for leukotriene D4 and thromboxane A2 receptors, on contractions induced by various agonists in the guinea pig trachea. Allergol Int. 2006 Dec;55(4):403-10. | ||||
| Ref 532003 | Stereocontrolled organocatalytic synthesis of prostaglandin PGF2alpha in seven steps. Nature. 2012 Sep 13;489(7415):278-81. | ||||
| Ref 534091 | G 619, a dual thromboxane synthase inhibitor and thromboxane A2 receptor antagonist, inhibits tumor necrosis factor-alpha biosynthesis. Eur J Pharmacol. 1995 Nov 3;286(1):31-9. | ||||
| Ref 534202 | Pharmacokinetic and pharmacodynamic properties of FK070 (KDI-792), a novel thromboxane receptor antagonist/thromboxane synthetase inhibitor, after single and multiple oral administrations to healthy volunteers. J Pharm Pharmacol. 1996 Apr;48(4):380-5. | ||||
| Ref 534431 | DTTX30, a combined thromboxane receptor antagonist and thromboxane synthetase inhibitor, prevents coronary thrombosis in anesthetized dogs. Basic Res Cardiol. 1997 Jun;92(3):181-90. | ||||
| Ref 534743 | In vitro pharmacologic profile of YM158, a new dual antagonist for LTD4 and TXA2 receptors. J Pharmacol Exp Ther. 1998 Nov;287(2):633-9. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536491 | Inhibition of cytochromes p450: existing and new promising therapeutic targets. Drug Metab Rev. 2007;39(2-3):481-99. | ||||
| Ref 536500 | Emerging therapies for treatment of acute lung injury and acute respiratory distress syndrome. Expert Opin Emerg Drugs. 2007 Sep;12(3):461-77. | ||||
| Ref 539183 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1882). | ||||
| Ref 539212 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1911). | ||||
| Ref 539272 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1976). | ||||
| Ref 539273 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1977). | ||||
| Ref 539275 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1979). | ||||
| Ref 539277 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1980). | ||||
| Ref 539283 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1986). | ||||
| Ref 539284 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1987). | ||||
| Ref 540312 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3356). | ||||
| Ref 541321 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6072). | ||||
| Ref 544519 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000039) | ||||
| Ref 544530 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000070) | ||||
| Ref 544557 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000129) | ||||
| Ref 544622 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000338) | ||||
| Ref 544623 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000341) | ||||
| Ref 544628 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000361) | ||||
| Ref 544641 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000402) | ||||
| Ref 544974 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001755) | ||||
| Ref 545002 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001843) | ||||
| Ref 545003 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001848) | ||||
| Ref 545054 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001983) | ||||
| Ref 545314 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002792) | ||||
| Ref 545440 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003261) | ||||
| Ref 545526 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003601) | ||||
| Ref 545658 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004057) | ||||
| Ref 545861 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005083) | ||||
| Ref 521733 | ClinicalTrials.gov (NCT00229437) Efficacy and Safety Study of TAK-128 in Treating Subjects With Diabetic Peripheral Neuropathy. U.S. National Institutes of Health. | ||||
| Ref 525673 | The utilization of recombinant prostanoid receptors to determine the affinities and selectivities of prostaglandins and related analogs. Biochim Biophys Acta. 2000 Jan 17;1483(2):285-93. | ||||
| Ref 526369 | Pharmacokinetic and pharmacodynamic properties of a new thromboxane receptor antagonist (Z-335) after single and multiple oral administrations to healthy volunteers. J Clin Pharmacol. 2002 Jul;42(7):782-90. | ||||
| Ref 526796 | Mouse thromboxane A2 receptor: cDNA cloning, expression and northern blot analysis. Biochem Biophys Res Commun. 1992 May 15;184(3):1197-203. | ||||
| Ref 526809 | 7-[(1R,2S,3S,5R)-6,6-dimethyl-3-(4- iodobenzenesulfonylamino)bicyclo[3.1.1]hept-2-yl]-5(Z)-heptenoic acid: a novel high-affinity radiolabeled antagonist for platelet thromboxane A2/prostaglandin H2 receptors. J Pharmacol Exp Ther. 1992 Aug;262(2):632-7. | ||||
| Ref 526825 | Effects of KW-3635, a novel dibenzoxepin derivative of a selective thromboxane A2 antagonist, on human, guinea pig and rat platelets. Jpn J Pharmacol. 1992 Jul;59(3):357-64. | ||||
| Ref 527205 | J Med Chem. 1992 Jun 12;35(12):2202-9.Synthesis and thromboxane A2/prostaglandin H2 receptor antagonistic activity of phenol derivatives. | ||||
| Ref 528120 | Terutroban and endothelial TP receptors in atherogenesis. Med Sci (Paris). 2006 Apr;22(4):437-43. | ||||
| Ref 528239 | J Med Chem. 2006 Jun 15;49(12):3701-9.Synthesis and pharmacological evaluation of novel nitrobenzenic thromboxane modulators as antiplatelet agents acting on both the alpha and beta isoforms of the human thromboxane receptor. | ||||
| Ref 528550 | Effects of KP-496, a novel dual antagonist for leukotriene D4 and thromboxane A2 receptors, on contractions induced by various agonists in the guinea pig trachea. Allergol Int. 2006 Dec;55(4):403-10. | ||||
| Ref 528672 | J Med Chem. 2007 Feb 22;50(4):794-806.Discovery of a potent and selective prostaglandin D2 receptor antagonist, [(3R)-4-(4-chloro-benzyl)-7-fluoro-5-(methylsulfonyl)-1,2,3,4-tetrahydrocyclopenta[b]indol-3-yl]-acetic acid (MK-0524). | ||||
| Ref 529292 | Anti-thrombotic effect of ONO-8809, a novel TXA2/PG endoperoxide receptor antagonist. Adv Prostaglandin Thromboxane Leukot Res. 1991;21B:599-602. | ||||
| Ref 529310 | J Med Chem. 1991 Apr;34(4):1511-4.Novel synthesis and biochemical properties of an [125I]-labeled photoaffinity probe for thromboxane A2/prostaglandin H2 receptors. | ||||
| Ref 529394 | Influence of SQ 30741 on thromboxane receptor-mediated responses in the feline pulmonary vascular bed. J Appl Physiol (1985). 1991 Nov;71(5):2012-8. | ||||
| Ref 529402 | The effects of thromboxane receptor blockade on platelet aggregation and digital skin blood flow in patients with secondary Raynaud's syndrome. Rheumatol Int. 1991;11(4-5):163-8. | ||||
| Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
| Ref 532727 | The PGI2-analogue iloprost and the TXA2-receptor antagonist sulotroban synergistically inhibit TXA2-dependent platelet activation. Prostaglandins. 1988 Dec;36(6):751-60. | ||||
| Ref 532986 | Characterization of an 125I-labeled thromboxane A2/prostaglandin H2 receptor agonist. J Pharmacol Exp Ther. 1989 Nov;251(2):557-62. | ||||
| Ref 533341 | EP 171: a high affinity thromboxane A2-mimetic, the actions of which are slowly reversed by receptor blockade. Br J Pharmacol. 1989 Apr;96(4):875-87. | ||||
| Ref 533342 | Difluorothromboxane A2 and stereoisomers: stable derivatives of thromboxane A2 with differential effects on platelets and blood vessels. Proc Natl Acad Sci U S A. 1989 Jul;86(14):5600-4. | ||||
| Ref 533391 | Characterization of [5,6-3H]SQ 29,548 as a high affinity radioligand, binding to thromboxane A2/prostaglandin H2-receptors in human platelets. J Pharmacol Exp Ther. 1988 Jun;245(3):786-92. | ||||
| Ref 533405 | Characterization of U46619 binding in unactivated, intact human platelets and determination of binding site affinities of four TXA2/PGH2 receptor antagonists (13-APA, BM 13.177, ONO 3708 and SQ 29,548). Thromb Res. 1986 Feb 15;41(4):471-81. | ||||
| Ref 533468 | Binding of thromboxane A2/prostaglandin H2 agonists to human platelets. Br J Pharmacol. 1987 May;91(1):223-7. | ||||
| Ref 533502 | Synthesis and in vitro pharmacology of 7-oxabicyclo[2.2.1]heptane analogues of thromboxane A2/PGH2. J Med Chem. 1985 Nov;28(11):1580-90. | ||||
| Ref 533593 | The effect of a TXA2 receptor antagonist ON-579 on experimental allergic reactions. Prostaglandins Leukot Essent Fatty Acids. 1995 Aug;53(2):123-33. | ||||
| Ref 533694 | The effect of a novel thromboxane A2 (TXA2) receptor antagonist (S-1452) on the antigen-induced bronchoconstriction and airway hyperresponsiveness in guinea pigs. Prostaglandins Leukot Essent Fatty Acids. 1993 May;48(5):343-9. | ||||
| Ref 533825 | Antithrombotic effects of KW-3635, a thromboxane A2-receptor antagonist, in guinea pigs. Jpn J Pharmacol. 1994 Jun;65(2):93-8. | ||||
| Ref 534051 | Synthesis and structure-activity relationships of novel benzimidazole and imidazo[4,5-b]pyridine acid derivatives as thromboxane A2 receptor antagonists. J Med Chem. 1993 Apr 30;36(9):1175-87. | ||||
| Ref 534091 | G 619, a dual thromboxane synthase inhibitor and thromboxane A2 receptor antagonist, inhibits tumor necrosis factor-alpha biosynthesis. Eur J Pharmacol. 1995 Nov 3;286(1):31-9. | ||||
| Ref 534176 | Azulene derivatives as TXA2/PGH2 receptor antagonists--II. Synthesis and biological activity of 6-mono- and 6-dihydroxylated-isopropylazulenes. Bioorg Med Chem. 1996 Apr;4(4):575-91. | ||||
| Ref 534202 | Pharmacokinetic and pharmacodynamic properties of FK070 (KDI-792), a novel thromboxane receptor antagonist/thromboxane synthetase inhibitor, after single and multiple oral administrations to healthy volunteers. J Pharm Pharmacol. 1996 Apr;48(4):380-5. | ||||
| Ref 534256 | Evidence for human thromboxane receptor heterogeneity using a novel series of 9,11-cyclic carbonate derivatives of prostaglandin F2 alpha. Br J Pharmacol. 1996 Mar;117(6):1171-80. | ||||
| Ref 534431 | DTTX30, a combined thromboxane receptor antagonist and thromboxane synthetase inhibitor, prevents coronary thrombosis in anesthetized dogs. Basic Res Cardiol. 1997 Jun;92(3):181-90. | ||||
| Ref 534478 | Ligand binding specificities of the eight types and subtypes of the mouse prostanoid receptors expressed in Chinese hamster ovary cells. Br J Pharmacol. 1997 Sep;122(2):217-24. | ||||
| Ref 534495 | Effects of the novel thromboxane (TXA2) receptor antagonist linotroban on inulin and para-aminohippuric acid clearances in the conscious male and female rat. Arzneimittelforschung. 1997 Sep;47(9):1026-30. | ||||
| Ref 534743 | In vitro pharmacologic profile of YM158, a new dual antagonist for LTD4 and TXA2 receptors. J Pharmacol Exp Ther. 1998 Nov;287(2):633-9. | ||||
| Ref 534906 | Flow after prostaglandin E1 is mediated by receptor-coupled adenylyl cyclase in human anterior segments. Invest Ophthalmol Vis Sci. 1999 Oct;40(11):2622-6. | ||||
| Ref 535888 | Thromboxane A2 inhibition: therapeutic potential in bronchial asthma. Am J Respir Med. 2002;1(1):11-7. | ||||
| Ref 536029 | AT-1 receptor antagonism modifies the mediation of endothelin-1, thromboxane A2, and catecholamines in the renal constrictor response to angiotensin II. Kidney Int Suppl. 2005 Jan;(93):S3-9. | ||||
| Ref 536488 | Participation in cysteinyl leukotrienes and thromboxane A2 in nasal congestion model in Brown Norway rats. Int Immunopharmacol. 2007 Nov;7(11):1483-7. Epub 2007 Jun 26. | ||||
| Ref 537194 | Chronic ouabain treatment exacerbates blood pressure elevation in spontaneously hypertensive rats: the role of vascular mechanisms. J Hypertens. 2009 Jun;27(6):1233-42. | ||||
| Ref 544028 | Effects of vapiprost, a novel thromboxane receptor antagonist, on thrombus formation and vascular patency after thrombolysis by tissue-type plasminogen activator.. Br J Pharmacol. 1992 July; 106(3): 533-538. | ||||
| Ref 545659 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004057) | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

