Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T40696
|
||||
| Former ID |
TTDS00083
|
||||
| Target Name |
Topoisomerase IV
|
||||
| Gene Name |
parC
|
||||
| Synonyms |
Topo IV; parC
|
||||
| Target Type |
Successful
|
||||
| Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
| Bacterial pneumonia [ICD10: J13, J15] | |||||
| Methicillin-resistant staphylococcus aureus infection [ICD10: B95.62] | |||||
| Mrsa infection [ICD9: 41.12; ICD10: A49.02] | |||||
| Ocular inflammation [ICD9: 370.33; ICD10: H16.229] | |||||
| Pneumonia [ICD10: J12-J18] | |||||
| Respiratory tract inflammation [ICD10: J00-J99] | |||||
| Respiratory tract infection [ICD9: 460-519; ICD10: J00-J99] | |||||
| Urinary tract infections [ICD9: 599; ICD10: N39.0] | |||||
| Unspecified [ICD code not available] | |||||
| BioChemical Class |
Topoisomerase GyrA ParC
|
||||
| Target Validation |
T40696
|
||||
| UniProt ID | |||||
| EC Number |
EC 5.99.1.-
|
||||
| Sequence |
MSEIIQDLSLEDVLGDRFGRYSKYIIQERALPDVRDGLKPVQRRILYAMYSSGNTHDKNF
RKSAKTVGDVIGQYHPHGDSSVYEAMVRLSQDWKLRHVLIEMHGNNGSIDNDPPAAMRYT EAKLSLLAEELLRDINKETVSFIPNYDDTTLEPMVLPSRFPNLLVNGSTGISAGYATDIP PHNLAEVIQATLKYIDNPDITVNQLMKYIKGPDFPTGGIIQGIDGIKKAYESGKGRIIVR SKVEEETLRNGRKQLIITEIPYEVNKSSLVKRIDELRADKKVDGIVEVRDETDRTGLRIA IELKKDVNSESIKNYLYKNSDLQISYNFNMVAISDGRPKLMGIRQIIDSYLNHQIEVVAN RTKFELDNAEKRMHIVEGLIKALSILDKVIELIRSSKNKRDAKENLIEVYEFTEEQAEAI VMLQLYRLTNTDIVALEGEHKELEALIKQLRHILDNHDALLNVIKEELNEIKKKFKSERL SLIEAEIEEIKIDKEVMVPSEEVILSMTRHGYIKRTSIRSFNASGVEDIGLKDGDSLLKH QEVNTQDTVLVFTNKGRYLFIPVHKLADIRWKELGQHVSQIVPIEEDEVVINVFNEKDFN TDAFYVFATQNGMIKKSTVPLFKTTRFNKPLIATKVKENDDLISVMRFEKDQLITVITNK GMSLTYNTSELSDTGLRAAGVKSINLKAEDFVVVTEGVSENDTILMATQRGSLKRISFKI LQVAKRAQRGITLLKELKKNPHRIVAAHVVTGEHSQYTLYSKSNEEHGLINDIHKSEQYT NGSFIVDTDDFGEVIDMYIS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Besifloxacin | Drug Info | Approved | Ocular inflammation | [530677], [531950] |
| Ciprofloxacin Hydrochloride | Drug Info | Approved | Bacterial infections | [551871] | |
| Finafloxacin | Drug Info | Approved | Urinary tract infections | [533123], [551871] | |
| Gatifloxacin | Drug Info | Approved | Respiratory tract infection | [536472] | |
| Gemifloxacin | Drug Info | Approved | Bacterial infections | [536094] | |
| Levofloxacin | Drug Info | Approved | Bacterial infections | [536773] | |
| Moxifloxacin | Drug Info | Approved | Bacterial infections | [536472] | |
| Sparfloxacin | Drug Info | Approved | Bacterial infections | [538553] | |
| ABT-492 | Drug Info | Phase 3 | Bacterial infections | [546643] | |
| Ciprofloxacin intratympanic - Otonomy | Drug Info | Phase 3 | Unspecified | [1559538] | |
| Nemonaxacin | Drug Info | Phase 3 | Methicillin-resistant staphylococcus aureus infection | [524857] | |
| Ozenoxacin | Drug Info | Phase 3 | Bacterial infections | [524682] | |
| Zabofloxacin | Drug Info | Phase 3 | Pneumonia | [524004] | |
| WCK-2349 | Drug Info | Phase 2 | Mrsa infection | [549471] | |
| WCK-771 | Drug Info | Phase 2 | Bacterial infections | [547481] | |
| WCK-1152 | Drug Info | Phase 1 | Respiratory tract inflammation | [547780] | |
| Avarofloxacin | Drug Info | Discontinued in Phase 2 | Bacterial pneumonia | [549103] | |
| DX-619 | Drug Info | Discontinued in Phase 2 | Bacterial infections | [547823] | |
| DK-507k | Drug Info | Discontinued in Phase 1 | Bacterial infections | [547478] | |
| CBR-2092 | Drug Info | Terminated | Bacterial infections | [548625] | |
| Modulator | ABT-492 | Drug Info | |||
| Avarofloxacin | Drug Info | [531620] | |||
| Besifloxacin | Drug Info | [530677], [531950] | |||
| CBR-2092 | Drug Info | ||||
| Ciprofloxacin Hydrochloride | Drug Info | [556264] | |||
| Ciprofloxacin intratympanic - Otonomy | Drug Info | ||||
| DK-507k | Drug Info | ||||
| DX-619 | Drug Info | [527893] | |||
| Finafloxacin | Drug Info | [533123] | |||
| Gatifloxacin | Drug Info | [556264] | |||
| Gemifloxacin | Drug Info | [556264] | |||
| Levofloxacin | Drug Info | [556264] | |||
| Moxifloxacin | Drug Info | [556264] | |||
| Nemonaxacin | Drug Info | ||||
| NSFQ-105 | Drug Info | ||||
| Ozenoxacin | Drug Info | ||||
| Sparfloxacin | Drug Info | [556264] | |||
| WCK-1152 | Drug Info | ||||
| WCK-2349 | Drug Info | ||||
| WCK-771 | Drug Info | ||||
| Zabofloxacin | Drug Info | ||||
| Inhibitor | Premafloxacin | Drug Info | [535701] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| DRM | DRM Info | ||||
| References | |||||
| Ref 524004 | ClinicalTrials.gov (NCT01658020) A Study to Evaluate Efficacy and Safety Profile of Zabofloxacin Tablet 400mg and Moxifloxacin Tablet 400mg. U.S. National Institutes of Health. | ||||
| Ref 524682 | ClinicalTrials.gov (NCT02090764) Efficacy and Safety of Ozenoxacin 1% Cream Versus Placebo in the Treatment of Patients With Impetigo. U.S. National Institutes of Health. | ||||
| Ref 524857 | ClinicalTrials.gov (NCT02205112) A Phase III Study to Evaluate the Efficacy and Safety of Intravenous Infusion of Nemonoxacin in Treating CAP. U.S. National Institutes of Health. | ||||
| Ref 531950 | Besifloxacin ophthalmic suspension, 0.6%: a novel topical fluoroquinolone for bacterial conjunctivitis. Adv Ther. 2012 Jun;29(6):473-90. | ||||
| Ref 536094 | Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98. | ||||
| Ref 536472 | Novel agents in the management of Mycobacterium tuberculosis disease. Curr Med Chem. 2007;14(18):2000-8. | ||||
| Ref 536773 | How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30. | ||||
| Ref 538553 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 020677. | ||||
| Ref 546643 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009417) | ||||
| Ref 547478 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016728) | ||||
| Ref 547481 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016734) | ||||
| Ref 547780 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019222) | ||||
| Ref 547823 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019670) | ||||
| Ref 548625 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027165) | ||||
| Ref 549103 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032241) | ||||
| Ref 549471 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800038027) | ||||
| Ref 527893 | DX-619, a novel des-fluoro(6) quinolone manifesting low frequency of selection of resistant Staphylococcus aureus mutants: quinolone resistance beyond modification of type II topoisomerases. Antimicrob Agents Chemother. 2005 Dec;49(12):5051-7. | ||||
| Ref 531620 | Antistaphylococcal activities of the new fluoroquinolone JNJ-Q2. Antimicrob Agents Chemother. 2011 Dec;55(12):5512-21. | ||||
| Ref 531950 | Besifloxacin ophthalmic suspension, 0.6%: a novel topical fluoroquinolone for bacterial conjunctivitis. Adv Ther. 2012 Jun;29(6):473-90. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

