Target General Infomation
Target ID
T02551
Former ID
TTDS00013
Target Name
D(3) dopamine receptor
Gene Name
DRD3
Synonyms
Dopamine receptor 3; DRD3
Target Type
Successful
Disease Bipolar disorder [ICD9: 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300; ICD10: F31, F40-F42]
Cocaine addiction [ICD9: 304.2; ICD10: F14.2]
Drug abuse [ICD9: 303-304; ICD10: F10-F19]
Emesis [ICD9: 787; ICD10: R11]
Emesis; Gastric motility disorder [ICD9: 294.1, 307.23, 314.00, 314.01, 320-322, 323, 331.0, 332, 333.4, 340, 344.1, 344.81, 348.0, 536.8, 787; ICD10: F02.2, F02.3, F90, F95.2, G00-G37, G83.5, G93.0]
Female sexual dysfunction [ICD9: 302.7; ICD10: F52]
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32]
Male sexual disorders [ICD10: F52]
Psychotic disorders [ICD9: 290-299; ICD10: F20-F29]
Parkinson's disease [ICD9: 332; ICD10: G20]
Schizophrenia [ICD9: 295; ICD10: F20]
Substance dependence [ICD10: F10-F19]
Unspecified [ICD code not available]
Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
BioChemical Class
GPCR rhodopsin
Target Validation
T02551
UniProt ID
Sequence
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Drugs and Mode of Action
Drug(s) Cariprazine Drug Info Approved Bipolar disorder [532651], [542650]
Pramipexole Drug Info Approved Parkinson's disease [536580], [543322]
Ropinirole Drug Info Approved Parkinson's disease [537532], [542315]
CM-2395 Drug Info Phase 3 Schizophrenia [551513]
P2B-001 Drug Info Phase 2/3 Parkinson's disease [524487]
GSK598809 Drug Info Phase 2 Drug abuse [523147]
GSK618334 Drug Info Phase 1 Drug abuse [522083]
Pfizer 10 Drug Info Phase 1 Female sexual dysfunction [536493]
F-15063 Drug Info Preclinical Schizophrenia [548528]
PD-157533 Drug Info Preclinical Schizophrenia [536463]
PD-157695 Drug Info Preclinical Schizophrenia [536463]
PD-158771 Drug Info Preclinical Schizophrenia [536463]
S-33084 Drug Info Preclinical Psychotic disorders [538794], [547145]
S32504 Drug Info Preclinical Parkinson's disease [526972]
U-99194A Drug Info Preclinical Schizophrenia [536463]
Quinelorane Drug Info Discontinued in Phase 3 Male sexual disorders [543323], [544908]
A-437203 Drug Info Discontinued in Phase 2 Psychotic disorders [547085]
BP-897 Drug Info Discontinued in Phase 2 Cocaine addiction [542612], [547037]
MAZAPERTINE Drug Info Discontinued in Phase 2 Discovery agent [545274]
AVE-5997 Drug Info Discontinued in Phase 1 Psychotic disorders [547685]
S-33138 Drug Info Discontinued in Phase 1 Psychotic disorders [547260]
AS-8112 Drug Info Terminated Emesis [546591]
AVE-5997EF Drug Info Terminated Schizophrenia [536463]
BP4.879a Drug Info Terminated Schizophrenia [536463]
BTS-79018 Drug Info Terminated Schizophrenia [536463]
E-2040 Drug Info Terminated Schizophrenia [546598]
GR-218231 Drug Info Terminated Discovery agent [542030], [546446]
PNU-177864 Drug Info Terminated Schizophrenia [536463]
PNU-96391A Drug Info Terminated Substance dependence [532971]
RGH-1756 Drug Info Terminated Schizophrenia [536463]
S32504 Drug Info Terminated Major depressive disorder [547082]
SB-277011 Drug Info Terminated Schizophrenia [536463], [538907]
YM-43611 Drug Info Terminated Psychotic disorders [546030]
Inhibitor (+)-3-(1-Propyl-piperidin-3-yl)-phenol Drug Info [533938]
(+)-BUTACLAMOL Drug Info [529789]
(+/-)-7-hydroxy-2-(N,N-di-n-propylamino)tetralin Drug Info [529836]
(+/-)-nantenine Drug Info [530558]
(-)-3-(1-Propyl-piperidin-3-yl)-benzonitrile Drug Info [533938]
(-)-5-hydroxy-2-(dipropylamino)tetralin Drug Info [530606]
(2-Benzyl-phenyl)-(2-pyrrolidin-1-yl-ethyl)-amine Drug Info [527160]
(4-Dipropylamino-cyclohexylidene)-acetonitrile Drug Info [525701]
(4-Ethynyl-cyclohex-3-enyl)-dipropyl-amine Drug Info [529734]
(4-Phenylethynyl-cyclohex-3-enyl)-dipropyl-amine Drug Info [525701]
(R)-(-)-2-Methyl-apomorphine hydrochloride Drug Info [529328]
(R)-(-)-2-Phenyl-apomorphine hydrochloride Drug Info [529328]
(R)-2-(Benzylamino-methyl)-chroman-7-ol Drug Info [526840]
1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine Drug Info [528099]
1-(4-(4-phenyl-1-piperazinyl)butyl)indolin-2-one Drug Info [528904]
1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine Drug Info [525629]
1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine Drug Info [525629]
1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine Drug Info [525629]
1-Benzyl-4-(3-oxazol-5-yl-pyrrol-1-yl)-piperidine Drug Info [525629]
1-Benzyl-4-pyrrol-1-yl-piperidine Drug Info [525629]
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine Drug Info [533570]
1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine Drug Info [551334]
1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine Drug Info [527160]
1-[2-(2-Benzyl-phenoxy)-ethyl]-pyrrolidine Drug Info [527160]
1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine Drug Info [527160]
2-(4-Dipropylamino-cyclohexylidene)-malononitrile Drug Info [525701]
3-(1-Propyl-pyrrolidin-3-yl)-phenol Drug Info [551334]
3-(2-Benzylamino-ethoxy)-phenol Drug Info [525599]
3-(4-Benzyl-piperazin-1-yl)-phenol Drug Info [534802]
3-(4-Methyl-piperidin-1-ylmethyl)-1H-indole Drug Info [534131]
3-(4-Phenyl-piperazin-1-ylmethyl)-1H-indole Drug Info [534131]
3-(4-Phenyl-piperidin-1-ylmethyl)-1H-indole Drug Info [534131]
4-(2-Benzylamino-ethoxy)-1,3-dihydro-indol-2-one Drug Info [525599]
4-(4-Benzyl-piperazin-1-yl)-1H-benzoimidazole Drug Info [534802]
4-(4-Benzyl-piperazin-1-yl)-1H-indole Drug Info [534802]
4-(4-Benzyl-piperazin-1-yl)-5-chloro-1H-indole Drug Info [534802]
4-(4-Benzyl-piperazin-1-yl)-7-bromo-1H-indole Drug Info [534802]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one Drug Info [531079]
4-Dipropylamino-cyclohex-1-enecarbonitrile Drug Info [525701]
A-690344 Drug Info [527867]
A-706149 Drug Info [527843]
A-987306 Drug Info [529789]
Azaperone Drug Info [533796]
Benzyl-[2-(1H-indazol-4-yloxy)-ethyl]-amine Drug Info [525599]
Benzyl-[2-(1H-indol-4-yloxy)-ethyl]-amine Drug Info [525599]
D-189 Drug Info [529420]
D-190 Drug Info [529420]
D-192 Drug Info [529420]
D-193 Drug Info [529420]
D-203 Drug Info [529420]
D-210 Drug Info [529420]
D-218 Drug Info [529420]
D-219 Drug Info [529420]
D-220 Drug Info [529420]
D-237 Drug Info [529836]
D-264 Drug Info [530117]
D-315 Drug Info [531014]
D-366 Drug Info [530606]
Etoloxamine Drug Info [527160]
FLUMEZAPINE Drug Info [533515]
FLUTROLINE Drug Info [533512]
GR-218231 Drug Info [529862]
ISOCLOZAPINE Drug Info [533570]
ISOLOXAPINE Drug Info [533577]
L-741626 Drug Info [551224]
L-741742 Drug Info [534132]
MAZAPERTINE Drug Info [533800]
N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide Drug Info [529734]
N-(4-Propylaminobutyl)-4-biphenylcarboxamide Drug Info [529734]
P2B-001 Drug Info [534641]
PG-01037 Drug Info [528974]
QUINPIROLE Drug Info [530429]
R-226161 Drug Info [528772]
SB-271046 Drug Info [529191]
SPIPERONE Drug Info [527420]
STEPHOLIDINE Drug Info [530374]
UH-232 Drug Info [551330]
[2-(1H-Benzoimidazol-4-yloxy)-ethyl]-benzyl-amine Drug Info [525599]
Antagonist (+)-AJ76 Drug Info [530381]
(+)-S-14297 Drug Info [533834]
AS-8112 Drug Info [536188]
AS-9705 Drug Info [536188]
AVE-5997 Drug Info [527957]
AVE-5997EF Drug Info [536463]
BP4.879a Drug Info [536463]
GSK598809 Drug Info [550963]
GSK618334 Drug Info [550963]
nafadotride Drug Info [534073]
NGB 2904 Drug Info [528948]
PD-157533 Drug Info [536463]
PD-157695 Drug Info [536463]
PD-158771 Drug Info [536463]
PNU-177864 Drug Info [536463]
RGH-1756 Drug Info [536463]
S-33138 Drug Info [531061], [551871]
SB-277011 Drug Info [536463]
[3H]nemonapride Drug Info [526842]
[3H]spiperone Drug Info [525818]
Agonist (-)-N-porphynorapomorphine Drug Info [533725]
7-trans-OH-PIPAT Drug Info [533838]
CM-2395 Drug Info [548980]
PD 128907 Drug Info [534074]
PF-592379 Drug Info [531866]
Pfizer 10 Drug Info [536493]
piribedil Drug Info [526443]
[3H]7-OH-DPAT Drug Info [533726]
[3H]PD128907 Drug Info [533687]
Modulator 7-OH-DPAT Drug Info
A-437203 Drug Info
BP-897 Drug Info
Cariprazine Drug Info [532651]
E-2040 Drug Info [546599]
F-15063 Drug Info
PD-152255 Drug Info
PNU-96391A Drug Info [532971]
Pramipexole Drug Info [556264]
Quinelorane Drug Info
Ropinirole Drug Info [556264]
S-33084 Drug Info [525807]
S32504 Drug Info [526972]
YM-43611 Drug Info
Binder BTS-79018 Drug Info [536463]
U-99194A Drug Info [536463]
Modulator (allosteric modulator) SB269652 Drug Info [533107]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Neuroactive ligand-receptor interaction
Dopaminergic synapse
Reactome Dopamine receptors
G alpha (i) signalling events
WikiPathways Monoamine GPCRs
GPCRs, Class A Rhodopsin-like
GPCR ligand binding
GPCR downstream signaling
Nicotine Activity on Dopaminergic Neurons
GPCRs, Other
References
Ref 522083ClinicalTrials.gov (NCT00513279) To Investigate If Single Doses Of GSK618334 Are Safe And To Investigate Blood Levels Of GSK618334. U.S. National Institutes of Health.
Ref 523147ClinicalTrials.gov (NCT01188967) Effectiveness of GSK598809, a Selective D3 Antagonist, Added to Cognitive Behavioral Therapy and Nicotine Replacement Therapy for Smoking Cessation and Prevention of Very Early Relapse to Smoking. U.S. National Institutes of Health.
Ref 524487ClinicalTrials.gov (NCT01968460) Safety, Tolerability and Efficacy of Two Doses of Once Daily P2B001 in Subjects With Early Parkinson's Disease. U.S. National Institutes of Health.
Ref 526972S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity in comparison to ropinirole. J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. Epub 2004 Feb 20.
Ref 5326512013 FDA drug approvals. Nat Rev Drug Discov. 2014 Feb;13(2):85-9.
Ref 532971The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9.
Ref 536463The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31.
Ref 536493Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. Epub 2007 Aug 27.
Ref 536580Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2.
Ref 537532Update on ropinirole in the treatment of Parkinson's disease. Neuropsychiatr Dis Treat. 2009;5:33-6. Epub 2009 Apr 8.
Ref 538794(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 129).
Ref 538907(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 143).
Ref 542030(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 70).
Ref 542315(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7295).
Ref 542612(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7625).
Ref 542650(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7671).
Ref 543322(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 953).
Ref 543323(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 954).
Ref 544908Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001472)
Ref 545274Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002662)
Ref 546030Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005975)
Ref 546446Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008161)
Ref 546591Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009088)
Ref 546598Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126)
Ref 547037Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012397)
Ref 547082Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012906)
Ref 547085Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012940)
Ref 547145Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013394)
Ref 547260Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014544)
Ref 547685Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018413)
Ref 548528Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026348)
Ref 551513Pharmaceutical Research Companies Are Developing More Than 300 Medicines to Treat Mental Illnesses. Pharmaceutical Research and Manufacturers of America report.2010.
Ref 525599Bioorg Med Chem Lett. 1999 Sep 6;9(17):2593-8.New generation dopaminergic agents. 7. Heterocyclic bioisosteres that exploit the 3-OH-phenoxyethylamine D2 template.
Ref 525629Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6.Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands.
Ref 525701J Med Chem. 2000 Feb 24;43(4):756-62.Conjugated enynes as nonaromatic catechol bioisosteres: synthesis, binding experiments, and computational studies of novel dopamine receptor agonists recognizing preferentially the D(3) subtype.
Ref 525807S33084, a novel, potent, selective, and competitive antagonist at dopamine D(3)-receptors: II. Functional and behavioral profile compared with GR218,231 and L741,626. J Pharmacol Exp Ther. 2000 Jun;293(3):1063-73.
Ref 525818Regulation of human D(1), d(2(long)), d(2(short)), D(3) and D(4) dopamine receptors by amiloride and amiloride analogues. Br J Pharmacol. 2000 Jul;130(5):1045-59.
Ref 526443Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804.
Ref 526840J Med Chem. 2003 Oct 9;46(21):4377-92.Molecular modeling of the three-dimensional structure of dopamine 3 (D3) subtype receptor: discovery of novel and potent D3 ligands through a hybrid pharmacophore- and structure-based database searching approach.
Ref 526842Potent activation of dopamine D3/D2 heterodimers by the antiparkinsonian agents, S32504, pramipexole and ropinirole. J Neurochem. 2003 Nov;87(3):631-41.
Ref 526972S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity in comparison to ropinirole. J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. Epub 2004 Feb 20.
Ref 527160J Med Chem. 2004 Aug 12;47(17):4155-8.Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 receptor selectivity.
Ref 527420J Med Chem. 2005 Feb 10;48(3):694-709.Modeling the similarity and divergence of dopamine D2-like receptors and identification of validated ligand-receptor complexes.
Ref 527843Bioorg Med Chem Lett. 2006 Feb;16(3):658-62. Epub 2005 Nov 2.Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: Quinolin(di)one and benzazepin(di)one derivatives. herve.geneste@abbott.com.
Ref 527867Bioorg Med Chem Lett. 2006 Feb;16(3):490-4. Epub 2005 Nov 11.Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: 1H-pyrimidin-2-one derivatives.
Ref 527957Effect of dopamine D3 antagonists on PPI in DBA/2J mice or PPI deficit induced by neonatal ventral hippocampal lesions in rats. Neuropsychopharmacology. 2006 Jul;31(7):1382-92. Epub 2005 Dec 14.
Ref 528099Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. Epub 2006 Mar 24.Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype.
Ref 528772Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. Epub 2007 Mar 21.Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-adrenoceptor antagonism.
Ref 528904Bioorg Med Chem. 2007 Sep 1;15(17):5811-8. Epub 2007 Jun 7.Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand.
Ref 528948Pharmacological actions of NGB 2904, a selective dopamine D3 receptor antagonist, in animal models of drug addiction. CNS Drug Rev. 2007 Summer;13(2):240-59.
Ref 528974J Med Chem. 2007 Aug 23;50(17):4135-46. Epub 2007 Aug 2.Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3 receptor ligands: potential substance abuse therapeutic agents.
Ref 529191Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists.
Ref 529328Bioorg Med Chem. 2008 Apr 1;16(7):3773-9. Epub 2008 Feb 5.Synthesis and neuropharmacological evaluation of 2-aryl- and alkylapomorphines.
Ref 529420J Med Chem. 2008 May 22;51(10):3005-19. Epub 2008 Apr 12.Bioisosteric heterocyclic versions of 7-{[2-(4-phenyl-piperazin-1-yl)ethyl]propylamino}-5,6,7,8-tetrahydronaphthalen-2-ol: identification of highly potent and selective agonists for dopamine D3 receptor with potent in vivo activity.
Ref 529734J Med Chem. 2008 Nov 13;51(21):6829-38. Epub 2008 Oct 4.Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies.
Ref 529789J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia.
Ref 529836J Med Chem. 2008 Dec 25;51(24):7806-19.Structurally constrained hybrid derivatives containing octahydrobenzo[g or f]quinoline moieties for dopamine D2 and D3 receptors: binding characterization at D2/D3 receptors and elucidation of a pharmacophore model.
Ref 529862Bioorg Med Chem. 2009 Jan 15;17(2):758-66. Epub 2008 Nov 24.Design, synthesis, and binding affinities of potential positron emission tomography (PET) ligands with optimal lipophilicity for brain imaging of the dopamine D3 receptor. Part II.
Ref 530117Bioorg Med Chem. 2009 Jun 1;17(11):3923-33. Epub 2009 Apr 19.Investigation of various N-heterocyclic substituted piperazine versions of 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-naphthalen-2-ol: effect on affinity and selectivity for dopamine D3 receptor.
Ref 530374Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. Epub 2009 Aug 20.Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities?.
Ref 530381Molecular cloning and characterization of a novel dopamine receptor (D3) as a target for neuroleptics. Nature. 1990 Sep 13;347(6289):146-51.
Ref 530429J Med Chem. 2009 Nov 12;52(21):6860-70.1,1'-Disubstituted ferrocenes as molecular hinges in mono- and bivalent dopamine receptor ligands.
Ref 530558Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine.
Ref 530606J Med Chem. 2010 Feb 11;53(3):1023-37.Development of (S)-N6-(2-(4-(isoquinolin-1-yl)piperazin-1-yl)ethyl)-N6-propyl-4,5,6,7-tetrahydrobenzo[d]-thiazole-2,6-diamine and its analogue as a D3 receptor preferring agonist: potent in vivo activity in Parkinson's disease animal models.
Ref 531014Bioorg Med Chem. 2010 Aug 1;18(15):5661-74. Epub 2010 Jun 12.Further delineation of hydrophobic binding sites in dopamine D(2)/D(3) receptors for N-4 substituents on the piperazine ring of the hybrid template 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-naphthalen-2-ol.
Ref 531061The dopamine D3 receptor antagonist, S33138, counters cognitive impairment in a range of rodent and primate procedures. Int J Neuropsychopharmacol. 2010 Sep;13(8):1035-51.
Ref 531079J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential.
Ref 531866Lack of abuse potential in a highly selective dopamine D3 agonist, PF-592,379, in drug self-administration and drug discrimination in rats. Behav Pharmacol. 2012 Jun;23(3):280-91.
Ref 5326512013 FDA drug approvals. Nat Rev Drug Discov. 2014 Feb;13(2):85-9.
Ref 532971The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9.
Ref 533107Investigation of the binding and functional properties of extended length D3 dopamine receptor-selective antagonists. Eur Neuropsychopharmacol. 2015 Sep;25(9):1448-61.
Ref 533512J Med Chem. 1980 Jun;23(6):635-43.Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines.
Ref 533515J Med Chem. 1982 Oct;25(10):1133-40.Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems.
Ref 533570J Med Chem. 1982 Jul;25(7):855-8.Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain.
Ref 533577J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain.
Ref 533687Characterization of binding of [3H]PD 128907, a selective dopamine D3 receptor agonist ligand, to CHO-K1 cells. Life Sci. 1995;57(15):1401-10.
Ref 533725A functional test identifies dopamine agonists selective for D3 versus D2 receptors. Neuroreport. 1995 Jan 26;6(2):329-32.
Ref 533726Radioligand binding characterization of putative dopamine D3 receptor in human peripheral blood lymphocytes with [3H]7-OH-DPAT. J Neuroimmunol. 1995 May;58(2):139-44.
Ref 533796J Med Chem. 1993 Nov 26;36(24):3929-36.Evaluation of the effects of the enantiomers of reduced haloperidol, azaperol, and related 4-amino-1-arylbutanols on dopamine and sigma receptors.
Ref 533800J Med Chem. 1994 Apr 15;37(8):1060-2.A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects.
Ref 533834S 14297, a novel selective ligand at cloned human dopamine D3 receptors, blocks 7-OH-DPAT-induced hypothermia in rats. Eur J Pharmacol. 1994 Aug 1;260(2-3):R3-5.
Ref 533838Iodinated 2-aminotetralins and 3-amino-1-benzopyrans: ligands for dopamine D2 and D3 receptors. J Med Chem. 1994 Nov 25;37(24):4245-50.
Ref 533938J Med Chem. 1993 Oct 15;36(21):3188-96.Substituted 3-phenylpiperidines: new centrally acting dopamine autoreceptor antagonists.
Ref 534073Nafadotride, a potent preferential dopamine D3 receptor antagonist, activates locomotion in rodents. J Pharmacol Exp Ther. 1995 Dec;275(3):1239-46.
Ref 534074Neurochemical and functional characterization of the preferentially selective dopamine D3 agonist PD 128907. J Pharmacol Exp Ther. 1995 Dec;275(3):1355-66.
Ref 534131J Med Chem. 1996 May 10;39(10):1941-2.3-((4-(4-Chlorophenyl)piperazin-1-yl)-methyl)-1H-pyrrolo-2,3-b-pyridine: an antagonist with high affinity and selectivity for the human dopamine D4 receptor.
Ref 534132J Med Chem. 1996 May 10;39(10):1943-5.5-(4-Chlorophenyl)-4-methyl-3-(1-(2-phenylethyl)piperidin-4-yl)isoxazole: a potent, selective antagonist at human cloned dopamine D4 receptors.
Ref 534641Pharmacology of pramipexole, a dopamine D3-preferring agonist useful in treating Parkinson's disease. Clin Neuropharmacol. 1998 May-Jun;21(3):141-51.
Ref 534802Bioorg Med Chem Lett. 1998 Oct 6;8(19):2675-80.New generation dopaminergic agents. 5. Heterocyclic bioisosteres that exploit the 3-OH-N1-phenylpiperazine dopaminergic template.
Ref 536188Emerging drugs for chemotherapy-induced emesis. Expert Opin Emerg Drugs. 2006 Mar;11(1):137-51.
Ref 536463The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31.
Ref 536493Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. Epub 2007 Aug 27.
Ref 546599Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126)
Ref 548980Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031127)
Ref 550963Clinical pipeline report, company report or official report of GlaxoSmithKline (2009).
Ref 551224Synthesis and characterization of selective dopamine D2 receptor antagonists. 2. Azaindole, benzofuran, and benzothiophene analogs of L-741,626. Bioorg Med Chem. 2010 Jul 15;18(14):5291-300. doi: 10.1016/j.bmc.2010.05.052. Epub 2010 May 24.
Ref 551330(Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997).
Ref 551334Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.