Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T05409
|
||||
| Former ID |
TTDS00449
|
||||
| Target Name |
Neutral endopeptidase
|
||||
| Gene Name |
MME
|
||||
| Synonyms |
CALLA; CD10; Common acute lymphocytic leukemia antigen; Enkephalinase; NEP; Neutral endopeptidase; Neutral endopeptidase 24.11; MME
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Acute decompensated heart failure; Renal dysfunction [ICD9: 428, 428.0, 584, 585; ICD10: I50, N17-N19] | ||||
| Brain injury [ICD10: S09.90] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Chronic pain [ICD9: 338.2,780; ICD10: R52.1-R52.2, G89] | |||||
| Female sexual dysfunction [ICD9: 302.7; ICD10: F52] | |||||
| Heart failure [ICD9: 428; ICD10: I50] | |||||
| Hypertension; Renal failure; Heart failure; Diabetic nephropathy [ICD9: 250, 401, 428, 580-599, 584, 585; ICD10: E08-E13, I10-I16, I50, N00-N29, N17, N18, N19] | |||||
| Hypotension [ICD9: 458, 796.3; ICD10: I95] | |||||
| Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Function |
Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids (PubMed:15283675, PubMed:8168535). Biologically important in the destruction of opioid peptides such as Met- and Leu-enkephalins by cleavage of a Gly-Phe bond (PubMed:17101991). Able to cleave angiotensin-1, angiotensin-2 and angiotensin 1-9 (PubMed:15283675). Involved in the degradation of atrial natriuretic factor (ANF) (PubMed:2531377, PubMed:2972276). Displays UV-inducible elastase activity toward skin preelastic and elastic fibers (PubMed:20876573).
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T05409
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.24.11
|
||||
| Sequence |
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY NKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYR AYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | LCZ696 | Drug Info | Approved | Heart failure | [533123] |
| Candoxatril | Drug Info | Phase 3 | Hypertension | [541627], [550674] | |
| Sampatrilat | Drug Info | Phase 2 | Hypotension | [525516] | |
| SLV 306 | Drug Info | Phase 2 | Acute decompensated heart failure; Renal dysfunction | [521684], [541643] | |
| SLV-334 | Drug Info | Phase 2 | Brain injury | [531869] | |
| Debio 0827 | Drug Info | Phase 1 | Chronic pain | [550597] | |
| GW-796406 | Drug Info | Phase 1 | Hypotension | [527730] | |
| Pfizer 4 | Drug Info | Phase 1 | Female sexual dysfunction | [536493] | |
| SLV-338 | Drug Info | Phase 1 | Cardiovascular disorder | [531611] | |
| Ilepatril | Drug Info | Discontinued in Phase 2/3 | Hypertension; Renal failure; Heart failure; Diabetic nephropathy | [536642] | |
| Fasidotril | Drug Info | Discontinued in Phase 2 | Hypotension | [541638], [545632] | |
| Gemopatrilat | Drug Info | Discontinued in Phase 2 | Hypotension | [546675] | |
| M-100240 | Drug Info | Discontinued in Phase 2 | Hypotension | [545322] | |
| SCH-32615 | Drug Info | Discontinued in Phase 2 | Pain | [545185] | |
| SCH-42495 | Drug Info | Discontinued in Phase 2 | Hypotension | [545085] | |
| Candoxatrilat | Drug Info | Discontinued in Phase 1 | Heart failure | [541626], [544971] | |
| GSK 796406 | Drug Info | Discontinued in Phase 1 | Hypertension | [549953] | |
| BMS-182657 | Drug Info | Terminated | Cardiovascular disorder | [533583] | |
| CGS-26303 | Drug Info | Terminated | Discovery agent | [546022] | |
| CGS-30440 | Drug Info | Terminated | Hypertension | [534574] | |
| GW-660511 | Drug Info | Terminated | Hypertension | [525698] | |
| Omapatrilat | Drug Info | Terminated | Hypertension | [526007] | |
| SCH-54470 | Drug Info | Terminated | Discovery agent | [546391] | |
| SQ-26332 | Drug Info | Terminated | Discovery agent | [544625] | |
| Inhibitor | 9-Mercaptomethyl-10-oxo-azecane-2-carboxylic acid | Drug Info | [533959] | ||
| Candoxatril | Drug Info | [536226], [536673] | |||
| Candoxatrilat | Drug Info | [526732], [531869] | |||
| CGS-26303 | Drug Info | [551340] | |||
| CGS-314447 | Drug Info | [551340] | |||
| compound 1b | Drug Info | [529216] | |||
| Debio 0827 | Drug Info | [550597] | |||
| fasidotrilat | Drug Info | [528271] | |||
| GSK 796406 | Drug Info | [549997] | |||
| LBQ657 | Drug Info | [543446] | |||
| Pfizer 4 | Drug Info | [536493] | |||
| Phosphoramidon | Drug Info | [535034] | |||
| SCH-32615 | Drug Info | [531695], [531869] | |||
| SCH-42495 | Drug Info | [531869], [534015] | |||
| SCH-54470 | Drug Info | [530505] | |||
| SQ-26332 | Drug Info | [527799] | |||
| Thiorphan | Drug Info | [535731] | |||
| [2(R,S)-2-Sulfanylheptanoyl]-Phe-Ala | Drug Info | [551393] | |||
| Modulator | BMS-182657 | Drug Info | [533583] | ||
| CGS-30440 | Drug Info | [534574] | |||
| Fasidotril | Drug Info | ||||
| Gemopatrilat | Drug Info | ||||
| GW-660511 | Drug Info | [525698] | |||
| GW-796406 | Drug Info | [549997] | |||
| Ilepatril | Drug Info | [536642] | |||
| LCZ696 | Drug Info | [533123] | |||
| M-100240 | Drug Info | ||||
| Omapatrilat | Drug Info | [526007] | |||
| RB-105 | Drug Info | ||||
| Sampatrilat | Drug Info | [525516] | |||
| SLV 306 | Drug Info | [531869], [535988] | |||
| SLV-334 | Drug Info | ||||
| SLV-338 | Drug Info | [531611] | |||
| Pathways | |||||
| KEGG Pathway | Renin-angiotensin system | ||||
| Hematopoietic cell lineage | |||||
| Protein digestion and absorption | |||||
| Alzheimer' | |||||
| s disease | |||||
| NetPath Pathway | EGFR1 Signaling Pathway | ||||
| TGF_beta_Receptor Signaling Pathway | |||||
| Reactome | Metabolism of Angiotensinogen to Angiotensins | ||||
| WikiPathways | Metabolism of Angiotensinogen to Angiotensins | ||||
| Primary Focal Segmental Glomerulosclerosis FSGS | |||||
| Alzheimers Disease | |||||
| References | |||||
| Ref 521684 | ClinicalTrials.gov (NCT00160225) Study to Evaluate the Efficacy and Safety of Daglutril Compared to Placebo on Top of Losartan in Type 2 Diabetics With Overt Nephropathy and Well Controlled Hypertension. U.S. National Institutes of Health. | ||||
| Ref 525516 | Sustained antihypertensive actions of a dual angiotensin-converting enzyme neutral endopeptidase inhibitor, sampatrilat, in black hypertensive subjects. Am J Hypertens. 1999 Jun;12(6):563-71. | ||||
| Ref 525698 | The effects of Z13752A, a combined ACE/NEP inhibitor, on responses to coronary artery occlusion; a primary protective role for bradykinin. Br J Pharmacol. 2000 Feb;129(4):671-80. | ||||
| Ref 526007 | Omapatrilat, a dual angiotensin-converting enzyme and neutral endopeptidase inhibitor, prevents fatty streak deposit in apolipoprotein E-deficient mice. Atherosclerosis. 2001 Apr;155(2):291-5. | ||||
| Ref 527730 | Mechanism of vasopeptidase inhibitor-induced plasma extravasation: comparison of omapatrilat and the novel neutral endopeptidase 24.11/angiotensin-converting enzyme inhibitor GW796406. J Pharmacol Exp Ther. 2005 Dec;315(3):1306-13. Epub 2005 Sep 6. | ||||
| Ref 531611 | Renoprotective effects of combined endothelin-converting enzyme/neutral endopeptidase inhibitor SLV338 in acute and chronic experimental renal damage. Clin Lab. 2011;57(7-8):507-15. | ||||
| Ref 531869 | The dual endothelin converting enzyme/neutral endopeptidase inhibitor SLV-306 (daglutril), inhibits systemic conversion of big endothelin-1 in humans. Life Sci. 2012 Oct 15;91(13-14):743-8. | ||||
| Ref 533583 | Cardiovascular effects of the novel dual inhibitor of neutral endopeptidase and angiotensin-converting enzyme BMS-182657 in experimental hypertension and heart failure. J Pharmacol Exp Ther. 1995 Nov;275(2):745-52. | ||||
| Ref 534574 | Antihypertensive and natriuretic effects of CGS 30440, a dual inhibitor of angiotensin-converting enzyme and neutral endopeptidase 24.11. J Pharmacol Exp Ther. 1998 Mar;284(3):974-82. | ||||
| Ref 536493 | Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. Epub 2007 Aug 27. | ||||
| Ref 536642 | Ilepatril (AVE-7688), a vasopeptidase inhibitor for the treatment of hypertension. Curr Opin Investig Drugs. 2008 Mar;9(3):301-9. | ||||
| Ref 541626 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6491). | ||||
| Ref 541627 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6492). | ||||
| Ref 541638 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6501). | ||||
| Ref 541643 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6506). | ||||
| Ref 544625 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000347) | ||||
| Ref 544971 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001740) | ||||
| Ref 545085 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002070) | ||||
| Ref 545185 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002402) | ||||
| Ref 545322 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002832) | ||||
| Ref 545632 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003997) | ||||
| Ref 546022 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005936) | ||||
| Ref 546391 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007872) | ||||
| Ref 546675 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009581) | ||||
| Ref 525516 | Sustained antihypertensive actions of a dual angiotensin-converting enzyme neutral endopeptidase inhibitor, sampatrilat, in black hypertensive subjects. Am J Hypertens. 1999 Jun;12(6):563-71. | ||||
| Ref 525698 | The effects of Z13752A, a combined ACE/NEP inhibitor, on responses to coronary artery occlusion; a primary protective role for bradykinin. Br J Pharmacol. 2000 Feb;129(4):671-80. | ||||
| Ref 526007 | Omapatrilat, a dual angiotensin-converting enzyme and neutral endopeptidase inhibitor, prevents fatty streak deposit in apolipoprotein E-deficient mice. Atherosclerosis. 2001 Apr;155(2):291-5. | ||||
| Ref 526732 | Candoxatril, an orally active neutral endopeptidase inhibitor, raises plasma atrial natriuretic factor and is natriuretic in essential hypertension. J Hypertens. 1992 Mar;10(3):271-7. | ||||
| Ref 527799 | J Med Chem. 2005 Oct 20;48(21):6523-43.Designed multiple ligands. An emerging drug discovery paradigm. | ||||
| Ref 528271 | Modelling of aldose reductase inhibitory activity of pyrrol-1-yl-acetic acid derivatives by means of multivariate statistics. Med Chem. 2005 Jul;1(4):321-6. | ||||
| Ref 529216 | Thiol-based angiotensin-converting enzyme 2 inhibitors: P1 modifications for the exploration of the S1 subsite. Bioorg Med Chem Lett. 2008 Jan 15;18(2):732-7. Epub 2007 Nov 19. | ||||
| Ref 530505 | J Med Chem. 2010 Jan 14;53(1):208-20.Phosphinic tripeptides as dual angiotensin-converting enzyme C-domain and endothelin-converting enzyme-1 inhibitors. | ||||
| Ref 531611 | Renoprotective effects of combined endothelin-converting enzyme/neutral endopeptidase inhibitor SLV338 in acute and chronic experimental renal damage. Clin Lab. 2011;57(7-8):507-15. | ||||
| Ref 531695 | The antinociceptive effects of SCH-32615, a neutral endopeptidase (enkephalinase) inhibitor, microinjected into the periaqueductal, ventral medulla and amygdala. Brain Res. 1990 Jun 18;520(1-2):123-30. | ||||
| Ref 531869 | The dual endothelin converting enzyme/neutral endopeptidase inhibitor SLV-306 (daglutril), inhibits systemic conversion of big endothelin-1 in humans. Life Sci. 2012 Oct 15;91(13-14):743-8. | ||||
| Ref 533583 | Cardiovascular effects of the novel dual inhibitor of neutral endopeptidase and angiotensin-converting enzyme BMS-182657 in experimental hypertension and heart failure. J Pharmacol Exp Ther. 1995 Nov;275(2):745-52. | ||||
| Ref 533959 | J Med Chem. 1993 Nov 26;36(24):3821-8.Design and synthesis of an orally active macrocyclic neutral endopeptidase 24.11 inhibitor. | ||||
| Ref 534015 | Endopeptidase 24.11 inhibition by SCH 42495 in essential hypertension. Hypertension. 1993 Jul;22(1):119-26. | ||||
| Ref 534574 | Antihypertensive and natriuretic effects of CGS 30440, a dual inhibitor of angiotensin-converting enzyme and neutral endopeptidase 24.11. J Pharmacol Exp Ther. 1998 Mar;284(3):974-82. | ||||
| Ref 535034 | Neprilysin, a novel target for ultraviolet B regulation of melanogenesis via melanocortins. J Invest Dermatol. 2000 Sep;115(3):381-7. | ||||
| Ref 535731 | Thiorphan enhances bradykinin-induced vascular relaxation in hypoxic/hyperkalaemic porcine coronary artery. J Pharm Pharmacol. 2003 Mar;55(3):339-45. | ||||
| Ref 535988 | Effect of single doses of SLV306, an inhibitor of both neutral endopeptidase and endothelin-converting enzyme, on pulmonary pressures in congestive heart failure. Am J Cardiol. 2004 Jul 15;94(2):237-9. | ||||
| Ref 536226 | Dual inhibition of angiotensin converting enzyme and neutral endopeptidase produces effective blood pressure control in spontaneously hypertensive rats. Bratisl Lek Listy. 2005;106(12):407-11. | ||||
| Ref 536493 | Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. Epub 2007 Aug 27. | ||||
| Ref 536642 | Ilepatril (AVE-7688), a vasopeptidase inhibitor for the treatment of hypertension. Curr Opin Investig Drugs. 2008 Mar;9(3):301-9. | ||||
| Ref 536673 | Neutral endopeptidase inhibitor suppresses the early phase of atrial electrical remodeling in a canine rapid atrial pacing model. Indian Pacing Electrophysiol J. 2008 Apr 1;8(2):102-13. | ||||
| Ref 543446 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1611). | ||||
| Ref 549997 | Mechanism of vasopeptidase inhibitor-induced plasma extravasation: comparison of omapatrilat and the novel neutral endopeptidase 24.11/angiotensin-converting enzyme inhibitor GW796406. J Pharmacol Exp Ther. 2005 Dec;315(3):1306-13. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

