Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T09058
|
||||
| Former ID |
TTDR00714
|
||||
| Target Name |
5T4 ONCOFETAL antigen
|
||||
| Gene Name |
TPBG
|
||||
| Synonyms |
Trophoblast glycoprotein; TPBG
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Hormone refractory prostate cancer [ICD9: 140-229, 185; ICD10: C61] | |||||
| Non-small cell lung cancer [ICD10: C33-C34] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a- dependent LRP6 internalization.
|
||||
| BioChemical Class |
Transmembrane protein
|
||||
| UniProt ID | |||||
| Sequence |
MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPD
QCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAEL AALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELIL NHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLD LSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDC HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLG IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | TroVax | Drug Info | Phase 3 | Hormone refractory prostate cancer | [521911] |
| Naptumomab estafenatox | Drug Info | Phase 2/3 | Solid tumours | [521947] | |
| CV-9201 | Drug Info | Phase 1/2 | Non-small cell lung cancer | [522696] | |
| PF-06263507 | Drug Info | Phase 1 | Cancer | [524349] | |
| Anatumomab mafenatox | Drug Info | Terminated | Breast cancer | [528658] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| References | |||||
| Ref 521911 | ClinicalTrials.gov (NCT00397345) TroVax Renal Immunotherapy Survival Trial. U.S. National Institutes of Health. | ||||
| Ref 521947 | ClinicalTrials.gov (NCT00420888) ABR-217620/Naptumomab Estafenatox With Interferon-alpha (IFN-alpha) Compared to IFN-alpha Alone in Patients With Advanced Renal Cell Carcinoma. U.S. National Institutes of Health. | ||||
| Ref 522696 | ClinicalTrials.gov (NCT00923312) Trial of an RNActive-Derived Cancer Vaccine in Stage IIIB/IV Non Small Cell Lung Cancer (NSCLC). U.S. National Institutes of Health. | ||||
| Ref 528658 | A phase II study of a 5T4 oncofoetal antigen tumour-targeted superantigen (ABR-214936) therapy in patients with advanced renal cell carcinoma. Br J Cancer. 2007 Feb 26;96(4):567-74. Epub 2007 Feb 6. | ||||
| Ref 531184 | Vaccination of metastatic renal cancer patients with MVA-5T4: a randomized, double-blind, placebo-controlled phase III study. Clin Cancer Res. 2010 Nov 15;16(22):5539-47. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

