Target General Infomation
Target ID
T10191
Former ID
TTDC00265
Target Name
T-cell surface glycoprotein CD4
Gene Name
CD4
Synonyms
T-cell surface antigen T4/Leu-3; CD4
Target Type
Clinical Trial
Disease Cancer [ICD9: 140-229; ICD10: C00-C96]
Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26]
Influenza virus [ICD10: J11.1]
Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86]
Psoriasis; Asthma [ICD9:696; ICD10: L40, J45]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Function
Accessory protein for MHC class-II antigen/T-cell receptor interaction. May regulate T-cell activation. Induces the aggregation of lipid rafts.
BioChemical Class
Immunoglobulin
Target Validation
T10191
UniProt ID
Sequence
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
Drugs and Mode of Action
Drug(s) TNX-355 Drug Info Phase 3 Human immunodeficiency virus infection [545563]
Zanolimumab Drug Info Phase 3 Lymphoma [521655]
BT-061 Drug Info Phase 2 Psoriasis; Asthma [522956], [533077]
Fluoropeptide vaccine Drug Info Phase 2 Influenza virus [524093]
LIPO-4 Drug Info Phase 1 Human immunodeficiency virus infection [521652]
Protein vaccines Drug Info Phase 1 Cancer [551003]
IDEC-151 Drug Info Discontinued in Phase 2 Rheumatoid arthritis [546305]
Binder TNX-355 Drug Info [536143]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cell adhesion molecules (CAMs)
Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway
Primary immunodeficiency
NetPath Pathway Leptin Signaling Pathway
Pathway Interaction Database TCR signaling in na&amp
#xef
ve CD4+ T cells
IL12-mediated signaling events
CXCR4-mediated signaling events
C-MYB transcription factor network
IL23-mediated signaling events
Arf1 pathway
Notch-mediated HES/HEY network
IL12 signaling mediated by STAT4
Reactome Binding and entry of HIV virion
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
PD-1 signaling
WikiPathways TCR Signaling Pathway
Cytokines and Inflammatory Response
Host Interactions of HIV factors
Defensins
HIV Life Cycle
TCR signaling
Costimulation by the CD28 family
References
Ref 521652ClinicalTrials.gov (NCT00121121) Safety of Intradermal Versus Intramuscular Administration of HIV Lipopeptides in HIV Uninfected Adult Volunteers. U.S. National Institutes of Health.
Ref 521655ClinicalTrials.gov (NCT00127881) Study of Human Monoclonal Antibody to Treat Mycosis Fungoides and Sezary Syndrome. U.S. National Institutes of Health.
Ref 522956ClinicalTrials.gov (NCT01072383) Safety and Efficacy of Multiple Doses of BT061 in Patients With Moderate to Severe Chronic Plaque Psoriasis. U.S. National Institutes of Health.
Ref 524093ClinicalTrials.gov (NCT01703923) An Exploratory Study of FP01 Lozenges in Subjects With Chronic Refractory Cough. U.S. National Institutes of Health.
Ref 533077A specific CD4 epitope bound by tregalizumab mediates activation of regulatory T cells by a unique signaling pathway. Immunol Cell Biol. 2015 Apr;93(4):396-405.
Ref 545563Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003716)
Ref 546305Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007359)
Ref 551003Clinical pipeline report, company report or official report of ImmunoFrontier Inc.
Ref 525728Comparative pharmacodynamics of keliximab and clenoliximab in transgenic mice bearing human CD4. J Pharmacol Exp Ther. 2000 Apr;293(1):33-41.
Ref 526971Vaccine-induced CD4+ T cell responses to MAGE-3 protein in lung cancer patients. J Immunol. 2004 Mar 1;172(5):3289-96.
Ref 527118A small peptide (CEL-1000) derived from the beta-chain of the human major histocompatibility complex class II molecule induces complete protection against malaria in an antigen-independent manner. Antimicrob Agents Chemother. 2004 Jul;48(7):2455-63.
Ref 528688Clinical efficacy of zanolimumab (HuMax-CD4): two phase 2 studies in refractory cutaneous T-cell lymphoma. Blood. 2007 Jun 1;109(11):4655-62. Epub 2007 Feb 20.
Ref 532427Long-term CD4(+) and CD8(+) T-cell responses induced in HIV-uninfected volunteers following intradermal or intramuscular administration of an HIV-lipopeptide vaccine (ANRS VAC16). Vaccine. 2013 Sep 13;31(40):4406-15.
Ref 532845A novel peptide-based pan-influenza A vaccine: a double blind, randomised clinical trial of immunogenicity and safety. Vaccine. 2015 Jan 3;33(2):396-402.
Ref 533138Tregalizumab (BT-061) increases regulatory T cell function. Boosting regulatory T-cell function with the humanized CD4-specific humanized monoclonal antibody Tregalizumab (BT-061). Immunol Cell Biol.2015 Apr;93(4):321-2.
Ref 536143Progress in targeting HIV-1 entry. Drug Discov Today. 2005 Aug 15;10(16):1085-94.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.