Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T10191
|
||||
| Former ID |
TTDC00265
|
||||
| Target Name |
T-cell surface glycoprotein CD4
|
||||
| Gene Name |
CD4
|
||||
| Synonyms |
T-cell surface antigen T4/Leu-3; CD4
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
| Influenza virus [ICD10: J11.1] | |||||
| Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
| Psoriasis; Asthma [ICD9:696; ICD10: L40, J45] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Function |
Accessory protein for MHC class-II antigen/T-cell receptor interaction. May regulate T-cell activation. Induces the aggregation of lipid rafts.
|
||||
| BioChemical Class |
Immunoglobulin
|
||||
| Target Validation |
T10191
|
||||
| UniProt ID | |||||
| Sequence |
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | TNX-355 | Drug Info | Phase 3 | Human immunodeficiency virus infection | [545563] |
| Zanolimumab | Drug Info | Phase 3 | Lymphoma | [521655] | |
| BT-061 | Drug Info | Phase 2 | Psoriasis; Asthma | [522956], [533077] | |
| Fluoropeptide vaccine | Drug Info | Phase 2 | Influenza virus | [524093] | |
| LIPO-4 | Drug Info | Phase 1 | Human immunodeficiency virus infection | [521652] | |
| Protein vaccines | Drug Info | Phase 1 | Cancer | [551003] | |
| IDEC-151 | Drug Info | Discontinued in Phase 2 | Rheumatoid arthritis | [546305] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cell adhesion molecules (CAMs) | ||||
| Antigen processing and presentation | |||||
| Hematopoietic cell lineage | |||||
| T cell receptor signaling pathway | |||||
| Primary immunodeficiency | |||||
| NetPath Pathway | Leptin Signaling Pathway | ||||
| Pathway Interaction Database | TCR signaling in na& | ||||
| #xef | |||||
| ve CD4+ T cells | |||||
| IL12-mediated signaling events | |||||
| CXCR4-mediated signaling events | |||||
| C-MYB transcription factor network | |||||
| IL23-mediated signaling events | |||||
| Arf1 pathway | |||||
| Notch-mediated HES/HEY network | |||||
| IL12 signaling mediated by STAT4 | |||||
| Reactome | Binding and entry of HIV virion | ||||
| Phosphorylation of CD3 and TCR zeta chains | |||||
| Translocation of ZAP-70 to Immunological synapse | |||||
| Generation of second messenger molecules | |||||
| PD-1 signaling | |||||
| WikiPathways | TCR Signaling Pathway | ||||
| Cytokines and Inflammatory Response | |||||
| Host Interactions of HIV factors | |||||
| Defensins | |||||
| HIV Life Cycle | |||||
| TCR signaling | |||||
| Costimulation by the CD28 family | |||||
| References | |||||
| Ref 521652 | ClinicalTrials.gov (NCT00121121) Safety of Intradermal Versus Intramuscular Administration of HIV Lipopeptides in HIV Uninfected Adult Volunteers. U.S. National Institutes of Health. | ||||
| Ref 521655 | ClinicalTrials.gov (NCT00127881) Study of Human Monoclonal Antibody to Treat Mycosis Fungoides and Sezary Syndrome. U.S. National Institutes of Health. | ||||
| Ref 522956 | ClinicalTrials.gov (NCT01072383) Safety and Efficacy of Multiple Doses of BT061 in Patients With Moderate to Severe Chronic Plaque Psoriasis. U.S. National Institutes of Health. | ||||
| Ref 524093 | ClinicalTrials.gov (NCT01703923) An Exploratory Study of FP01 Lozenges in Subjects With Chronic Refractory Cough. U.S. National Institutes of Health. | ||||
| Ref 533077 | A specific CD4 epitope bound by tregalizumab mediates activation of regulatory T cells by a unique signaling pathway. Immunol Cell Biol. 2015 Apr;93(4):396-405. | ||||
| Ref 545563 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003716) | ||||
| Ref 525728 | Comparative pharmacodynamics of keliximab and clenoliximab in transgenic mice bearing human CD4. J Pharmacol Exp Ther. 2000 Apr;293(1):33-41. | ||||
| Ref 526971 | Vaccine-induced CD4+ T cell responses to MAGE-3 protein in lung cancer patients. J Immunol. 2004 Mar 1;172(5):3289-96. | ||||
| Ref 527118 | A small peptide (CEL-1000) derived from the beta-chain of the human major histocompatibility complex class II molecule induces complete protection against malaria in an antigen-independent manner. Antimicrob Agents Chemother. 2004 Jul;48(7):2455-63. | ||||
| Ref 528688 | Clinical efficacy of zanolimumab (HuMax-CD4): two phase 2 studies in refractory cutaneous T-cell lymphoma. Blood. 2007 Jun 1;109(11):4655-62. Epub 2007 Feb 20. | ||||
| Ref 532427 | Long-term CD4(+) and CD8(+) T-cell responses induced in HIV-uninfected volunteers following intradermal or intramuscular administration of an HIV-lipopeptide vaccine (ANRS VAC16). Vaccine. 2013 Sep 13;31(40):4406-15. | ||||
| Ref 532845 | A novel peptide-based pan-influenza A vaccine: a double blind, randomised clinical trial of immunogenicity and safety. Vaccine. 2015 Jan 3;33(2):396-402. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

