Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T16601
|
||||
| Former ID |
TTDR00681
|
||||
| Target Name |
Carcinoembryonic antigen-related cell adhesion molecule 5
|
||||
| Gene Name |
CEACAM5
|
||||
| Synonyms |
CD66e antigen; CEA; Carcinoembryonic antigen; Meconium antigen 100; CEACAM5
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | |||||
| Glioblastoma multiforme [ICD9: 191; ICD10: C71] | |||||
| Metastatic medullary thyroid cancer [ICD9: 193; ICD10: C73] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Small-cell lung cancer [ICD9: 162.9; ICD10: C33-C34] | |||||
| Function |
Cell surface glycoprotein that plays a role in cell adhesion and in intracellular signaling. Receptor for E.coli Dr adhesins.
|
||||
| BioChemical Class |
Immunoglobulin
|
||||
| UniProt ID | |||||
| Sequence |
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQ
HLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFY TLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWV NNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAP TISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNN QSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTI SPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQAN NSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQS LPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISP PDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNL ATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | CAP1-6D | Drug Info | Phase 2 | Pancreatic cancer | [521707] |
| CeaVac | Drug Info | Phase 2 | Colorectal cancer | [521450] | |
| DNA fusion vaccine | Drug Info | Phase 2 | Cancer | [549707] | |
| IDM-2101 | Drug Info | Phase 2 | Colorectal cancer | [529705] | |
| Labetuzumab I-131 | Drug Info | Phase 2 | Colorectal cancer | [527751] | |
| Pentacea | Drug Info | Phase 2 | Small-cell lung cancer | [547157] | |
| AVX701 | Drug Info | Phase 1/2 | Colorectal cancer | [522116] | |
| CT84.66 | Drug Info | Phase 1/2 | Breast cancer | [522271] | |
| SAR408701 | Drug Info | Phase 1/2 | Solid tumours | [524831] | |
| 123-Iodine-labeled MFE-23 | Drug Info | Phase 1 | Cancer | [530224] | |
| CIGB-M3 | Drug Info | Phase 1 | Colorectal cancer | [531534] | |
| GI-6207 | Drug Info | Phase 1 | Metastatic medullary thyroid cancer | [524297] | |
| MV-CEA | Drug Info | Phase 1 | Glioblastoma multiforme | [530664] | |
| RG7813 | Drug Info | Phase 1 | Solid tumours | [549518] | |
| KSB-303 | Drug Info | Discontinued in Phase 1/2 | Colorectal cancer | [546628] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
| References | |||||
| Ref 521450 | ClinicalTrials.gov (NCT00003125) Vaccine Therapy, Interleukin-2, and Sargramostim in Treating Patients With Advanced Tumors. U.S. National Institutes of Health. | ||||
| Ref 521707 | ClinicalTrials.gov (NCT00203892) Study of CAP1-6D in Patients With Locally Advanced or Surgically Resected Pancreatic Adenocarcinoma. U.S. National Institutes of Health. | ||||
| Ref 522116 | ClinicalTrials.gov (NCT00529984) A Phase I/II Study With CEA(6D) VRP Vaccine in Patients With Advanced or Metastatic CEA-Expressing Malignancies. U.S. National Institutes of Health. | ||||
| Ref 522271 | ClinicalTrials.gov (NCT00645710) Hepatic Arterial Infusion of Floxuridine, Gemcitabine Hydrochloride, and Radiolabeled Monoclonal Antibody Therapy in Treating Liver Metastases in Patients With Metastatic Colorectal Cancer Previously Treated With Surgery. U.S. National Institutes of Health. | ||||
| Ref 524297 | ClinicalTrials.gov (NCT01856920) A Phase 2 Study of GI-6207 in Patients With Recurrent Medullary Thyroid Cancer. U.S. National Institutes of Health. | ||||
| Ref 524831 | ClinicalTrials.gov (NCT02187848) Evaluation of SAR408701 in Patients With Advanced Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 527751 | Phase II trial of carcinoembryonic antigen radioimmunotherapy with 131I-labetuzumab after salvage resection of colorectal metastases in the liver: five-year safety and efficacy results. J Clin Oncol.2005 Sep 20;23(27):6763-70. | ||||
| Ref 529705 | Induction of immune responses and clinical efficacy in a phase II trial of IDM-2101, a 10-epitope cytotoxic T-lymphocyte vaccine, in metastatic non-small-cell lung cancer. J Clin Oncol. 2008 Sep 20;26(27):4418-25. | ||||
| Ref 530224 | A phase I trial of radioimmunotherapy with 131I-A5B7 anti-CEA antibody in combination with combretastatin-A4-phosphate in advanced gastrointestinal carcinomas. Clin Cancer Res. 2009 Jul 1;15(13):4484-92. | ||||
| Ref 530664 | Phase I trial of intraperitoneal administration of an oncolytic measles virus strain engineered to express carcinoembryonic antigen for recurrent ovarian cancer. Cancer Res. 2010 Feb 1;70(3):875-82. | ||||
| Ref 531534 | Phase I clinical trial of the (131)I-labeled anticarcinoembryonic antigen CIGB-M3 multivalent antibody fragment. Cancer Biother Radiopharm. 2011 Jun;26(3):353-63. | ||||
| Ref 546628 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009269) | ||||
| Ref 547157 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013510) | ||||
| Ref 524831 | ClinicalTrials.gov (NCT02187848) Evaluation of SAR408701 in Patients With Advanced Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 525630 | Clinical and immune responses in resected colon cancer patients treated with anti-idiotype monoclonal antibody vaccine that mimics the carcinoembryonic antigen. J Clin Oncol. 1999 Sep;17(9):2889-5. | ||||
| Ref 529705 | Induction of immune responses and clinical efficacy in a phase II trial of IDM-2101, a 10-epitope cytotoxic T-lymphocyte vaccine, in metastatic non-small-cell lung cancer. J Clin Oncol. 2008 Sep 20;26(27):4418-25. | ||||
| Ref 530664 | Phase I trial of intraperitoneal administration of an oncolytic measles virus strain engineered to express carcinoembryonic antigen for recurrent ovarian cancer. Cancer Res. 2010 Feb 1;70(3):875-82. | ||||
| Ref 530852 | HLA-A*0201-restricted CEA-derived peptide CAP1 is not a suitable target for T-cell-based immunotherapy. J Immunother. 2010 May;33(4):402-13. | ||||
| Ref 531534 | Phase I clinical trial of the (131)I-labeled anticarcinoembryonic antigen CIGB-M3 multivalent antibody fragment. Cancer Biother Radiopharm. 2011 Jun;26(3):353-63. | ||||
| Ref 531635 | Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36. | ||||
| Ref 534511 | Identification of an enhancer agonist cytotoxic T lymphocyte peptide from human carcinoembryonic antigen. Cancer Res. 1997 Oct 15;57(20):4570-7. | ||||
| Ref 543726 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2836). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

