Target General Infomation
Target ID
T18779
Former ID
TTDR00730
Target Name
Mucin 1
Gene Name
MUC1
Synonyms
Breast carcinoma-associated antigen DF3; CD227 antigen; Carcinoma-associated mucin; EMA; Episialin; H23AG; MUC-1; PEM; PEMT; PUM; Peanut-reactive urinary mucin; Polymorphic epithelial mucin; Tumor-associated epithelial membraneantigen; Tumor-associated mucin; Tumour-associated antigen mucin 1; MUC1
Target Type
Clinical Trial
Disease Acute myeloid leukemia [ICD9: 205; ICD10: C92.0]
Breast cancer [ICD9: 174, 175; ICD10: C50]
Bipolar disorder [ICD9: 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300; ICD10: F31, F40-F42]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21]
Late-stage solid tumors [ICD9: 140-199, 210-229; ICD10: C00-C75, C7A, C7B, D10-D36, D3A]
Multiple myeloma [ICD9: 203; ICD10: C90]
Non-small cell lung cancer [ICD10: C33-C34]
Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Unspecified [ICD code not available]
Function
May play a role in adhesive functions and in cell-cell interactions, metastasis and signaling. May provide a protective layer on epithelial surfaces. Direct or indirect interaction with actin cytoskeleton.isoform 7 behaves as a receptor.
BioChemical Class
Transmembrane protein
UniProt ID
Sequence
MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSV
LSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTS
APDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTS
ASGSASGSASTLVHNGTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHS
SVPPLTSSNHSTSPQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQI
YKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVS
VSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPAR
DTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
Drugs and Mode of Action
Drug(s) Yttrium (90Y) clivatuzumab tetraxetan Drug Info Phase 3 Pancreatic cancer [524457], [542962]
TG-4010 Drug Info Phase 2/3 Bipolar disorder [529572]
AS-1402 Drug Info Phase 2 Breast cancer [530436]
Emepepimut-S Drug Info Phase 2 Non-small cell lung cancer [522556]
ICO-25 Drug Info Phase 2 Breast cancer [528859]
MUC1-Poly-ICLC Drug Info Phase 2 Colorectal cancer [522466]
Pankomab-GEX Drug Info Phase 2 Cancer [524367]
BrevaRex Drug Info Phase 1/2 Pancreatic cancer [546767]
GO-203-2c Drug Info Phase 1/2 Late-stage solid tumors [524854]
ImMucin Drug Info Phase 1/2 Multiple myeloma [523236]
Anti-MUC1 mab Drug Info Phase 1 Pancreatic cancer [551561]
G0-203-2c Drug Info Phase 1 Acute myeloid leukemia [550808]
MUC-1 dendritic cancer vaccine Drug Info Phase 1 Cancer [549570]
ONT-10 Drug Info Phase 1 Solid tumours [523839]
SAR-566658 Drug Info Phase 1 Solid tumours [523101]
Modulator Anti-MUC1 mab Drug Info [526269]
BrevaRex mab Drug Info [527298]
G0-203-2c Drug Info [550809]
TG-1031 Drug Info
TG-4010 Drug Info [529572]
Inhibitor GO-203-2c Drug Info [550809]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
WikiPathways Hematopoietic Stem Cell Differentiation
References
Ref 522466ClinicalTrials.gov (NCT00773097) Study of the MUC1 Peptide-Poly-ICLC Adjuvant Vaccine in Individuals With Advanced Colorectal Adenoma. U.S. National Institutes of Health.
Ref 522556ClinicalTrials.gov (NCT00828009) BLP25 Liposome Vaccine and Bevacizumab After Chemotherapy and Radiation Therapy in Treating Patients With Newly Diagnosed Stage IIIA or Stage IIIB Non-Small Cell LungCancer That Cannot Be Removed by Surgery. U.S. National Institutes of Health.
Ref 523101ClinicalTrials.gov (NCT01156870) First in Man Study of SAR566658 Administered in Patients With CA6-Positive and Refractory Solid Tumor. U.S. National Institutes of Health.
Ref 523236ClinicalTrials.gov (NCT01232712) A Study to Assess the Safety and Efficacy of MUC1 Peptide Vaccine and hGM-CSF in Patients With MUC1-positive Tumor Malignancies. U.S. National Institutes of Health.
Ref 523839ClinicalTrials.gov (NCT01556789) Phase 1 Study of ONT-10 in Patients With Solid Tumors. U.S. National Institutes of Health.
Ref 524367ClinicalTrials.gov (NCT01899599) PankoMab-GEX Versus Placebo as Maintenance Therapy in Advanced Ovarian Cancer. U.S. National Institutes of Health.
Ref 524457ClinicalTrials.gov (NCT01956812) Phase 3 Trial of 90Y-Clivatuzumab Tetraxetan & Gemcitabine vs Placebo & Gemcitabine in Metastatic Pancreatic Cancer. U.S. National Institutes of Health.
Ref 524854ClinicalTrials.gov (NCT02204085) A Phase I/II Trial of the MUC1 Inhibitor, GO-203-2C in Patients With Relapsed or Refractory Acute Myeloid Leukemia. U.S. National Institutes of Health.
Ref 528859Atemonate and Imuteran: novel Russian monoclonal antibody-based therapeutic agents. Biotechnol J. 2007 Jul;2(7):863-70.
Ref 529572A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44.
Ref 530436Phase I dose escalation pharmacokinetic assessment of intravenous humanized anti-MUC1 antibody AS1402 in patients with advanced breast cancer. Breast Cancer Res. 2009;11(5):R73.
Ref 542962(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8087).
Ref 546767Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010209)
Ref 549570Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041064)
Ref 550808Clinical pipeline report, company report or official report of Genus 0ncology.
Ref 551561Clinical pipeline report, company report or official report of Quest PharmaTech.
Ref 526269Characterization of an anti-MUC1 monoclonal antibody with potential as a cancer vaccine. Hybrid Hybridomics. 2001;20(5-6):313-24.
Ref 526513The role of epithelial antigens in diagnosis and staging of breast cancer. Arkh Patol. 2002 Nov-Dec;64(6):13-5.
Ref 526717Dendritic cell vaccine immunotherapy of cancer targeting MUC1 mucin. Int J Mol Med. 2003 Oct;12(4):493-502.
Ref 527298Phase I trial of a murine antibody to MUC1 in patients with metastatic cancer: evidence for the activation of humoral and cellular antitumor immunity. Ann Oncol. 2004 Dec;15(12):1825-33.
Ref 529572A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44.
Ref 530436Phase I dose escalation pharmacokinetic assessment of intravenous humanized anti-MUC1 antibody AS1402 in patients with advanced breast cancer. Breast Cancer Res. 2009;11(5):R73.
Ref 531524Emepepimut-S for non-small cell lung cancer. Expert Opin Biol Ther. 2011 Aug;11(8):1091-7.
Ref 532171Staining of MUC1 in ovarian cancer tissues with PankoMab-GEX detecting the tumour-associated epitope, TA-MUC1, as compared to antibodies HMFG-1 and 115D8. Histol Histopathol. 2013 Feb;28(2):239-44.
Ref 532411Early in vivo signaling profiles in MUC1-specific CD4+ T cells responding to two different MUC1-targeting vaccines in two different microenvironments. Oncoimmunology. 2013 Mar 1;2(3):e23429.
Ref 533070Phase I/II study exploring ImMucin, a pan-major histocompatibility complex, anti-MUC1 signal peptide vaccine, in multiple myeloma patients. Br J Haematol. 2015 Apr;169(1):44-56.
Ref 549969Integrating in vitro signaling and drug response data from single cell network profiling (SCNP) to inform on individual's AML biology.Molecular Cancer Therapeutics. 11/2011; 10(Supplement 1):A73-A73.
Ref 550809Clinical pipeline report, company report or official report of Genus Oncology.
Ref 551008Clinical pipeline report, company report or official report of Immunomedics.
Ref 551470Clinical pipeline report, company report or official report of Oncothyreon.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.