Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T18972
|
||||
| Former ID |
TTDNC00504
|
||||
| Target Name |
CD3
|
||||
| Gene Name |
CD3G
|
||||
| Synonyms |
CD3g; T-cell receptor T3 gamma chain; T-cell surface glycoprotein CD3 gamma chain; CD3G
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Advanced breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
| Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
| Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | |||||
| Gastrointestinal adenocarcinoma [ICD10: C15-C26] | |||||
| Non-hodgkin's lymphoma [ICD10: C85] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
The CD3 complex mediates signal transduction.
|
||||
| UniProt ID | |||||
| Sequence |
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGK
MIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLF AEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLR RN |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ertumaxomab | Drug Info | Phase 2 | Breast cancer | [529707], [531972] |
| AFM11 | Drug Info | Phase 1 | Non-hodgkin's lymphoma | [524703] | |
| Autologous T-cell therapy | Drug Info | Phase 1 | Prostate cancer | [525412] | |
| Ertumaxomab | Drug Info | Phase 1 | Advanced breast cancer | [889343] | |
| MEDI-565 | Drug Info | Phase 1 | Gastrointestinal adenocarcinoma | [523334] | |
| MGD007 | Drug Info | Phase 1 | Colorectal cancer | [889404] | |
| MT-110 | Drug Info | Phase 1 | Solid tumours | [531707] | |
| Pathways | |||||
| KEGG Pathway | Hematopoietic cell lineage | ||||
| T cell receptor signaling pathway | |||||
| Chagas disease (American trypanosomiasis) | |||||
| Measles | |||||
| HTLV-I infection | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| PANTHER Pathway | T cell activation | ||||
| Pathway Interaction Database | TCR signaling in na& | ||||
| #xef | |||||
| ve CD4+ T cells | |||||
| IL12-mediated signaling events | |||||
| TCR signaling in na& | |||||
| ve CD8+ T cells | |||||
| CXCR4-mediated signaling events | |||||
| Downstream signaling in na& | |||||
| IL12 signaling mediated by STAT4 | |||||
| Reactome | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
| Phosphorylation of CD3 and TCR zeta chains | |||||
| Translocation of ZAP-70 to Immunological synapse | |||||
| Generation of second messenger molecules | |||||
| FCGR activation | |||||
| Regulation of actin dynamics for phagocytic cup formation | |||||
| Role of phospholipids in phagocytosis | |||||
| PD-1 signaling | |||||
| WikiPathways | TCR Signaling Pathway | ||||
| Fcgamma receptor (FCGR) dependent phagocytosis | |||||
| TCR signaling | |||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| Costimulation by the CD28 family | |||||
| References | |||||
| Ref 523334 | ClinicalTrials.gov (NCT01284231) A Study to Evaluate the Safety and Tolerability of MEDI-565 in Adults With Gastrointestinal Adenocarcinomas. U.S. National Institutes of Health. | ||||
| Ref 524703 | ClinicalTrials.gov (NCT02106091) Safety Study to Assess AFM11 in Patients With Relapsed and/or Refractory CD19 Positive B-cell NHL or B-precursor ALL. U.S. National Institutes of Health. | ||||
| Ref 525412 | Clinical application of genetically modified T cells in cancer therapy. Clin Transl Immunology. 2014 May 16;3(5):e16. doi: 10.1038/cti.2014.7. eCollection 2014. | ||||
| Ref 529707 | Ertumaxomab: a trifunctional antibody for breast cancer treatment. Expert Opin Investig Drugs. 2008 Oct;17(10):1553-8. | ||||
| Ref 531707 | EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74. | ||||
| Ref 531972 | Trifunctional antibody ertumaxomab: Non-immunological effects on Her2 receptor activity and downstream signaling. MAbs. 2012 Sep-Oct;4(5):614-22. | ||||
| Ref 529707 | Ertumaxomab: a trifunctional antibody for breast cancer treatment. Expert Opin Investig Drugs. 2008 Oct;17(10):1553-8. | ||||
| Ref 531707 | EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74. | ||||
| Ref 531972 | Trifunctional antibody ertumaxomab: Non-immunological effects on Her2 receptor activity and downstream signaling. MAbs. 2012 Sep-Oct;4(5):614-22. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

