Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T20178
|
||||
| Former ID |
TTDS00131
|
||||
| Target Name |
Tumor necrosis factor
|
||||
| Gene Name |
TNF
|
||||
| Synonyms |
Cachectin; TNF alpha; TNF-a; TNF-alpha; TNFalpha; Tumor necrosis factor ligand superfamily member 2; Tumor necrosis factor receptor 1; Tumour necrosis factor; Tumour necrosis factor alpha; TNF
|
||||
| Target Type |
Successful
|
||||
| Disease | Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4] | ||||
| Autoimmune diabetes [ICD10: E08-E13] | |||||
| Arthritis [ICD9: 710-719; ICD10: M00-M25] | |||||
| Asthma [ICD10: J45] | |||||
| Atopic dermatitis; Psoriatic disorder [ICD9:691.8, 692.9, 696; ICD10: L00-L99, L40] | |||||
| Crohn's disease [ICD9: 555; ICD10: K50] | |||||
| Colitis [ICD9: 556.9; ICD10: K50-K52] | |||||
| Crohn's disease; Ulcerative colitis; Rheumatoid arthritis; Ankylosing spondylitis; Psoriatic arthritis; Plaque psoriasis [ICD10: K50.0, K51.90, M05.9, M45.3, L40.52, L40] | |||||
| Diarrhea [ICD9: 787.91; ICD10: A09, K59.1] | |||||
| Esophageal cancer [ICD9: 150; ICD10: C15] | |||||
| Heart transplant rejection [ICD9: 996; ICD10: T86] | |||||
| Intermittent claudication [ICD9: 440.21; ICD10: I73.9] | |||||
| Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
| Multiple myeloma; Anaemia [ICD9:203, 280-285, 585.9585.1-585.5403; ICD10: C90, D50-D64, N18] | |||||
| Motor neurone disease; Amyotropic lateral sclerosis [ICD9: 335.2; ICD10: G12.2] | |||||
| Multiple myeloma [ICD9: 203; ICD10: C90] | |||||
| Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
| Ocular disease [ICD10: H00-H59] | |||||
| Osteoarthritis [ICD9: 715; ICD10: M15-M19, M47] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Pemphigus vulgaris; Vasculitis; Wegener's granulomatosis [ICD10: C91-C95, J45, J84.1, L80, M081, M45, M35.0, M40-M54, T86.0] | |||||
| Pneumonia [ICD10: J12-J18] | |||||
| Psoriatic disorder [ICD9: 696; ICD10: L40] | |||||
| Rheumatold arthritis; Psoriatic arthritis; Ankylosing spondylitis [ICD9: 696.0, 710-719, 714, 720.0; ICD10: L40.5, M00-M25, M05-M06, M07, M08.1, M45] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Rheumatoid arthritis; Dermatomyositis; Polymyositis; Juvenile rheumatoid arthritis; Graft-versus-host disease; Esophagitis [ICD10: K20, L40, M05-M06, M08.0, T86.0] | |||||
| Rheumatoid arthritis; Psoriasis [ICD9: 696, 710-719, 714; ICD10: L40, M00-M25, M05-M06] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Sciatica [ICD10: M54.3-M54.4] | |||||
| Sepsis [ICD9: 995.91; ICD10: A40, A41] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
|
||||
| BioChemical Class |
Cytokine: tumor necrosis factor
|
||||
| Target Validation |
T20178
|
||||
| UniProt ID | |||||
| Sequence |
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Adalimumab | Drug Info | Approved | Rheumatoid arthritis | [468081], [536711] |
| Certolizumab | Drug Info | Approved | Rheumatoid arthritis | [536651] | |
| Certolizumab pegol | Drug Info | Approved | Unspecified | [551871] | |
| Enbrel | Drug Info | Approved | Active rheumatoid arthritis | [1560300] | |
| Etanercept | Drug Info | Approved | Active rheumatoid arthritis | [556264] | |
| Golimumab | Drug Info | Approved | Rheumatold arthritis; Psoriatic arthritis; Ankylosing spondylitis | [530676], [530677], [541856] | |
| Infliximab | Drug Info | Approved | Crohn's disease; Ulcerative colitis; Rheumatoid arthritis; Ankylosing spondylitis; Psoriatic arthritis; Plaque psoriasis | [468124], [536688], [889446] | |
| Lenalidomide | Drug Info | Approved | Multiple myeloma; Anaemia | [537114], [542355], [551186], [551871] | |
| Pentoxifylline | Drug Info | Approved | Intermittent claudication | [536772], [542101] | |
| Thalidomide | Drug Info | Approved | Multiple myeloma | [536775], [542350] | |
| ABP 501 | Drug Info | Phase 3 | Rheumatoid arthritis | [549501] | |
| Etanercept | Drug Info | Phase 3 | Sciatica | [526617], [541869] | |
| Golnerminogene pradenovac | Drug Info | Phase 3 | Esophageal cancer | [521542] | |
| Infliximab | Drug Info | Phase 3 | Asthma | [468124], [536711] | |
| Golimumab | Drug Info | Phase 2/3 | Inflammatory bowel disease | [530677], [541856] | |
| ABT-122 | Drug Info | Phase 2 | Rheumatoid arthritis | [525076], [889413] | |
| AN0128 | Drug Info | Phase 2 | Atopic dermatitis; Psoriatic disorder | [549847] | |
| AP-301-IH | Drug Info | Phase 2 | Pneumonia | [524690] | |
| DLX-105 | Drug Info | Phase 2 | Osteoarthritis | [523949] | |
| ESBA-105 | Drug Info | Phase 2 | Ocular disease | [522546] | |
| Etanercept | Drug Info | Phase 2 | Pemphigus vulgaris; Vasculitis; Wegener's granulomatosis | [889316], [889317], [889318], [889319], [889323], [889324], [889328], [889329], [889330], [889331], [889332], [889333], [889334], [889346], [889362], [889363], [889384], [889419] | |
| Infliximab | Drug Info | Phase 2 | Rheumatoid arthritis; Dermatomyositis; Polymyositis; Juvenile rheumatoid arthritis; Graft-versus-host disease; Esophagitis | [889320], [889321], [889322], [889325], [889335], [889336], [889337], [889342], [889347], [889355] | |
| IP-751 | Drug Info | Phase 2 | Neuropathic pain | [536374] | |
| Pegsunercept | Drug Info | Phase 2 | Rheumatoid arthritis | [522132] | |
| RDP58 | Drug Info | Phase 2 | Diarrhea | [535681] | |
| TNF alpha kinoid | Drug Info | Phase 2 | Autoimmune diabetes | [524387] | |
| COVA322 | Drug Info | Phase 1/2a | Psoriasis | [889403] | |
| ART621 | Drug Info | Phase 1/2 | Rheumatoid arthritis; Psoriasis | [537117] | |
| CYT-609 | Drug Info | Phase 1 | Solid tumours | [548408] | |
| PF-05230905 | Drug Info | Phase 1 | Rheumatoid arthritis | [523333] | |
| PF-06410293 | Drug Info | Phase 1 | Rheumatoid arthritis | [525336] | |
| PF-06438179 | Drug Info | Phase 1 | Rheumatoid arthritis | [524274] | |
| PMI-005 | Drug Info | Phase 1 | Osteoarthritis | [522849] | |
| ABX-0401 | Drug Info | Preclinical | Inflammatory bowel disease | [547909] | |
| Celastrol | Drug Info | Preclinical | Motor neurone disease; Amyotropic lateral sclerosis | [536447] | |
| Genz29155 | Drug Info | Preclinical | Heart transplant rejection | [537129] | |
| CDP571 | Drug Info | Discontinued in Phase 3 | Crohn's disease | [545606] | |
| Segard | Drug Info | Discontinued in Phase 3 | Sepsis | [545307] | |
| Camobucol | Drug Info | Discontinued in Phase 2 | Rheumatoid arthritis | [547347] | |
| CRx-191 | Drug Info | Discontinued in Phase 2 | Psoriatic disorder | [548453] | |
| CytoFab | Drug Info | Discontinued in Phase 2 | Sepsis | [546117] | |
| AME-527 | Drug Info | Discontinued in Phase 1/2 | Rheumatoid arthritis | [547779] | |
| CYT-007-TNFQb | Drug Info | Discontinued in Phase 1/2 | Allergic rhinitis | [548071] | |
| ALS-00T2-0501 | Drug Info | Discontinued in Phase 1 | Psoriasis | [548268] | |
| FR-133605 | Drug Info | Terminated | Arthritis | [534263] | |
| MDL-201112 | Drug Info | Terminated | Colitis | [546299] | |
| TNFQb therapeutic vaccines | Drug Info | Terminated | Crohn's disease | [549297] | |
| Modulator | ABT-122 | Drug Info | |||
| ALS-00T2-0501 | Drug Info | [1572591] | |||
| CDP571 | Drug Info | ||||
| Certolizumab pegol | Drug Info | [533160] | |||
| COVA322 | Drug Info | [889442] | |||
| CYT-609 | Drug Info | [544154] | |||
| DOM-0215 | Drug Info | [1572605] | |||
| Enbrel | Drug Info | ||||
| Etanercept | Drug Info | [889443] | |||
| FR-133605 | Drug Info | [534263] | |||
| Golnerminogene pradenovac | Drug Info | [527709] | |||
| Inhibitor | ABX-0401 | Drug Info | [550134] | ||
| AN0128 | Drug Info | [536282], [536599], [551129] | |||
| AP-301-IH | Drug Info | [532192] | |||
| ART621 | Drug Info | [537117] | |||
| BAICALEIN | Drug Info | [531164] | |||
| Camobucol | Drug Info | [527425] | |||
| Certolizumab | Drug Info | [536651] | |||
| CRx-191 | Drug Info | [551126] | |||
| CYT-007-TNFQb | Drug Info | [544452] | |||
| Genz29155 | Drug Info | [537129] | |||
| IK-682 | Drug Info | [526446] | |||
| IP-751 | Drug Info | [536374] | |||
| Isopropyl Alcohol | Drug Info | [551374] | |||
| Lenalidomide | Drug Info | [536378], [537229] | |||
| MDL-201112 | Drug Info | [533875] | |||
| Pegsunercept | Drug Info | [529415] | |||
| PF-05230905 | Drug Info | [549168] | |||
| PF-06438179 | Drug Info | [532736] | |||
| PKF-241-466 | Drug Info | [526335] | |||
| PKF-242-484 | Drug Info | [526335] | |||
| PMI-005 | Drug Info | [551903] | |||
| RDP58 | Drug Info | [535681] | |||
| Thalidomide | Drug Info | [536993] | |||
| Y-39041 | Drug Info | [535084] | |||
| Suppressor | Celastrol | Drug Info | [536447] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Cytokine-cytokine receptor interaction | |||||
| NF-kappa B signaling pathway | |||||
| Sphingolipid signaling pathway | |||||
| mTOR signaling pathway | |||||
| Apoptosis | |||||
| TGF-beta signaling pathway | |||||
| Osteoclast differentiation | |||||
| Antigen processing and presentation | |||||
| Toll-like receptor signaling pathway | |||||
| NOD-like receptor signaling pathway | |||||
| RIG-I-like receptor signaling pathway | |||||
| Hematopoietic cell lineage | |||||
| Natural killer cell mediated cytotoxicity | |||||
| T cell receptor signaling pathway | |||||
| Fc epsilon RI signaling pathway | |||||
| TNF signaling pathway | |||||
| Adipocytokine signaling pathway | |||||
| Type II diabetes mellitus | |||||
| Non-alcoholic fatty liver disease (NAFLD) | |||||
| Type I diabetes mellitus | |||||
| Alzheimer' | |||||
| s disease | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| Pertussis | |||||
| Legionellosis | |||||
| Leishmaniasis | |||||
| Chagas disease (American trypanosomiasis) | |||||
| African trypanosomiasis | |||||
| Malaria | |||||
| Toxoplasmosis | |||||
| Amoebiasis | |||||
| Tuberculosis | |||||
| Hepatitis C | |||||
| Hepatitis B | |||||
| Influenza A | |||||
| HTLV-I infection | |||||
| Herpes simplex infection | |||||
| Proteoglycans in cancer | |||||
| Asthma | |||||
| Inflammatory bowel disease (IBD) | |||||
| Systemic lupus erythematosus | |||||
| Rheumatoid arthritis | |||||
| Allograft rejection | |||||
| Graft-versus-host disease | |||||
| Hypertrophic cardiomyopathy (HCM) | |||||
| Dilated cardiomyopathy | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| IL3 Signaling Pathway | |||||
| IL4 Signaling Pathway | |||||
| Leptin Signaling Pathway | |||||
| RANKL Signaling Pathway | |||||
| IL1 Signaling Pathway | |||||
| PANTHER Pathway | Apoptosis signaling pathway | ||||
| Wnt signaling pathway | |||||
| Pathway Interaction Database | IL27-mediated signaling events | ||||
| Canonical NF-kappaB pathway | |||||
| Calcineurin-regulated NFAT-dependent transcription in lymphocytes | |||||
| Angiopoietin receptor Tie2-mediated signaling | |||||
| Signaling events mediated by HDAC Class I | |||||
| TNF receptor signaling pathway | |||||
| Ceramide signaling pathway | |||||
| amb2 Integrin signaling | |||||
| RXR and RAR heterodimerization with other nuclear receptor | |||||
| IL23-mediated signaling events | |||||
| Negative effector of Fas and TNF-alpha | |||||
| Caspase Cascade in Apoptosis | |||||
| Cellular roles of Anthrax toxin | |||||
| Downstream signaling in na& | |||||
| #xef | |||||
| ve CD8+ T cells | |||||
| PathWhiz Pathway | Fc Epsilon Receptor I Signaling in Mast Cells | ||||
| Reactome | Transcriptional regulation of white adipocyte differentiation | ||||
| TNFR1-induced proapoptotic signaling | |||||
| Regulation of TNFR1 signaling | |||||
| TNFR1-induced NFkappaB signaling pathway | |||||
| TNFR1-mediated ceramide production | |||||
| TNFR2 non-canonical NF-kB pathway | |||||
| TNF signaling | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| Monoamine Transport | |||||
| SIDS Susceptibility Pathways | |||||
| TGF Beta Signaling Pathway | |||||
| Cytokines and Inflammatory Response | |||||
| MAPK Signaling Pathway | |||||
| EV release from cardiac cells and their functional effects | |||||
| FAS pathway and Stress induction of HSP regulation | |||||
| Apoptosis-related network due to altered Notch3 in ovarian cancer | |||||
| Cardiac Hypertrophic Response | |||||
| Transcriptional Regulation of White Adipocyte Differentiation | |||||
| Aryl Hydrocarbon Receptor | |||||
| Apoptosis | |||||
| Nanoparticle triggered regulated necrosis | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| Adipogenesis | |||||
| Allograft Rejection | |||||
| TNF alpha Signaling Pathway | |||||
| TWEAK Signaling Pathway | |||||
| Extrinsic Pathway for Apoptosis | |||||
| Folate Metabolism | |||||
| MicroRNAs in cardiomyocyte hypertrophy | |||||
| Vitamin B12 Metabolism | |||||
| Selenium Micronutrient Network | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| Matrix Metalloproteinases | |||||
| References | |||||
| Ref 468081 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4860). | ||||
| Ref 468124 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5004). | ||||
| Ref 521542 | ClinicalTrials.gov (NCT00051467) A Study of TNFerade Biologic With 5-FU and Radiation Therapy for First-Line Treatment of Unresectable Locally Advanced Pancreatic Cancer. U.S. National Institutes of Health. | ||||
| Ref 522546 | ClinicalTrials.gov (NCT00823173) Exploratory Study on Topical ESBA105 in Acute Anterior Uveitis. U.S. National Institutes of Health. | ||||
| Ref 522849 | ClinicalTrials.gov (NCT01010919) A Study of Chicory for Treatment of Osteoarthritis of the Hip or Knee. U.S. National Institutes of Health. | ||||
| Ref 523333 | ClinicalTrials.gov (NCT01284036) A Single Dose Study Of The Safety And Investigational Product Level Measurement In Healthy Subjects. U.S. National Institutes of Health. | ||||
| Ref 523949 | ClinicalTrials.gov (NCT01624376) Randomized, Double-blind, Placebo-controlled Study in Patients With Fistulizing Crohn's Disease. U.S. National Institutes of Health. | ||||
| Ref 524274 | ClinicalTrials.gov (NCT01844804) A Pharmacokinetics Study Comparing PF-06438179 and Infliximab in Healthy Volunteers (REFLECTIONS B537-01). U.S. National Institutes of Health. | ||||
| Ref 524387 | ClinicalTrials.gov (NCT01911234) Clinical Efficacy of TNF-Kinoid in Patients With Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
| Ref 524690 | ClinicalTrials.gov (NCT02095626) Study in Intensive Care Patients Regarding the Effect of Inhaled AP-301 After Primary Graft Dysfunction After Lung Transplantation. U.S. National Institutes of Health. | ||||
| Ref 525076 | ClinicalTrials.gov (NCT02349451) A Phase 2 Study to Investigate the Safety, Tolerability and Efficacy of ABT-122 in Subjects With Active Psoriatic Arthritis Who Have an Inadequate Response to Methotrexate. U.S. National Institutes of Health. | ||||
| Ref 525336 | ClinicalTrials.gov (NCT02572245) A Study of PF-06410293 Following Subcutaneous Administration Using A Prefilled Syringe Or A Prefilled Pen In Healthy Adult Subjects. | ||||
| Ref 526617 | Etanercept, a TNF antagonist for treatment for psoriatic arthritis and psoriasis. Skin Therapy Lett. 2003 Jan;8(1):1-4. | ||||
| Ref 530676 | Golimumab: a tumor necrosis factor alpha inhibitor for the treatment of rheumatoid arthritis. Ann Pharmacother. 2010 Jan;44(1):135-44. | ||||
| Ref 534263 | Effect of FR133605, a novel cytokine suppressive agent, on bone and cartilage destruction in adjuvant arthritic rats. J Rheumatol. 1996 Oct;23(10):1778-83. | ||||
| Ref 535681 | RDP58, a locally active TNF inhibitor, is effective in the dextran sulphate mouse model of chronic colitis. Inflamm Res. 2002 Nov;51(11):522-31. | ||||
| Ref 536447 | Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52. | ||||
| Ref 536688 | Drug insight: tumor necrosis factor-converting enzyme as a pharmaceutical target for rheumatoid arthritis. Nat Clin Pract Rheumatol. 2008 Jun;4(6):300-9. Epub 2008 Apr 15. | ||||
| Ref 536711 | Molecular targets of rheumatoid arthritis. Inflamm Allergy Drug Targets. 2008 Mar;7(1):53-66. | ||||
| Ref 536772 | New drugs in development for the treatment of endometriosis. Expert Opin Investig Drugs. 2008 Aug;17(8):1187-202. | ||||
| Ref 536775 | Thalidomide in multiple myeloma--clinical trials and aspects of drug metabolism and toxicity. Expert Opin Drug Metab Toxicol. 2008 Jul;4(7):973-85. | ||||
| Ref 537129 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | ||||
| Ref 541856 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6776). | ||||
| Ref 541869 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6789). | ||||
| Ref 542101 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7095). | ||||
| Ref 542350 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7327). | ||||
| Ref 542355 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7331). | ||||
| Ref 545307 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002771) | ||||
| Ref 545606 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003884) | ||||
| Ref 546117 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006437) | ||||
| Ref 546299 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007330) | ||||
| Ref 547347 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015375) | ||||
| Ref 547779 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019215) | ||||
| Ref 547909 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020354) | ||||
| Ref 548071 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021664) | ||||
| Ref 548268 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023971) | ||||
| Ref 548408 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025369) | ||||
| Ref 548453 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025635) | ||||
| Ref 549297 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034853) | ||||
| Ref 549501 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800038738) | ||||
| Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| Ref 889319 | ClinicalTrials.gov (NCT00006070) Etanercept (Enbrel) to Treat Pain and Swelling After Third Molar Extraction | ||||
| Ref 889320 | ClinicalTrials.gov (NCT00006292) Infliximab for the Treatment of Early Rheumatoid Arthritis | ||||
| Ref 889321 | ClinicalTrials.gov (NCT00029042) Infliximab to Treat Children With Juvenile Rheumatoid Arthritis | ||||
| Ref 889322 | ClinicalTrials.gov (NCT00033891) Infliximab (Remicade ) to Treat Dermatomyositis and Polymyositis | ||||
| Ref 889323 | ClinicalTrials.gov (NCT00034060) The Role of Cytokines on Growth Hormone Suppression in Premenopausal Women With Rheumatoid Arthritis and the Effect of Treatment With Etanercept | ||||
| Ref 889324 | ClinicalTrials.gov (NCT00063869) Study Evaluating the Safety and Efficacy of Etanercept in Patients With Idiopathic Pulmonary Fibrosis | ||||
| Ref 889325 | ClinicalTrials.gov (NCT00076726) A Study of the Safety and Effectiveness of Infliximab (Remicade) in Patients With Giant Cell Arteritis | ||||
| Ref 889329 | ClinicalTrials.gov (NCT00134368) Study of the Efficacy and Safety of Etanercept in Adults With Vitiligo | ||||
| Ref 889330 | ClinicalTrials.gov (NCT00135720) Study of Etanercept (Enbrel) in the Treatment of Pemphigus Vulgaris | ||||
| Ref 889331 | ClinicalTrials.gov (NCT00141713) The Use of Etanercept (Enbrel) in the Treatment of Acute Graft-Versus-Host Disease | ||||
| Ref 889332 | ClinicalTrials.gov (NCT00141726) Study of Enbrel (Etanercept) for the Treatment Sub-Acute Pulmonary Dysfunction After Allogeneic Stem Cell Transplant | ||||
| Ref 889333 | ClinicalTrials.gov (NCT00141739) Study of Etanercept for the Prevention of Complications Resulting From Hematopoietic Stem Cell Transplantation (HSCT) | ||||
| Ref 889335 | ClinicalTrials.gov (NCT00201799) Infliximab for the Prevention of Graft-versus-Host Disease Following Allogenic Hematopoietic Stem Cell Transplantation | ||||
| Ref 889336 | ClinicalTrials.gov (NCT00230529) A Safety and Efficacy Study of Infliximab (Remicade) in Patients With Plaque Type Psoriasis | ||||
| Ref 889337 | ClinicalTrials.gov (NCT00244192) Effects of Infliximab (Remicade) on Fat Free Mass in Patients With Moderate to Severe COPD Suffering From Cachexia | ||||
| Ref 889342 | ClinicalTrials.gov (NCT00443222) Treatment With TNF Blockade, Infliximab, in Patients With Myositis | ||||
| Ref 889347 | ClinicalTrials.gov (NCT00523354) Off Label Use of Infliximab in Adult Patients With Severe Eosinophilic Esophagitis | ||||
| Ref 889362 | ClinicalTrials.gov (NCT01289730) Etanercept (Enbrel) in Undifferentiated Spondyloarthritis | ||||
| Ref 889384 | ClinicalTrials.gov (NCT01730495) Tumor Necrosis Factor-alpha Inhibition Using Etanercept in Chronic Fatigue Syndrome | ||||
| Ref 889403 | ClinicalTrials.gov (NCT02243787) Safety and Tolerability Study of COVA322 in Patients With Stable Chronic Moderate-to-severe Plaque Psoriasis | ||||
| Ref 889413 | ClinicalTrials.gov (NCT02433340) Phase 2, Multicenter, Open-Label Extension (OLE) Study With ABT-122 in Rheumatoid Arthritis Subjects Who Have Completed the Preceding M12-963 Study | ||||
| Ref 526068 | Randomized, placebo-controlled trial of the anti-tumor necrosis factor antibody fragment afelimomab in hyperinflammatory response during severe sepsis: The RAMSES Study. Crit Care Med. 2001 Apr;29(4):765-9. | ||||
| Ref 526335 | J Med Chem. 2002 May 23;45(11):2289-93.Beta-aryl-succinic acid hydroxamates as dual inhibitors of matrix metalloproteinases and tumor necrosis factor alpha converting enzyme. | ||||
| Ref 526446 | J Med Chem. 2002 Nov 7;45(23):4954-7.Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structure-activity relationships. | ||||
| Ref 526555 | Cyclic AMP inhibition of tumor necrosis factor alpha production induced by amyloidogenic C-terminal peptide of Alzheimer's amyloid precursor protein in macrophages: involvement of multiple intracellular pathways and cyclic AMP response element binding protein. Mol Pharmacol. 2003 Mar;63(3):690-8. | ||||
| Ref 527425 | AGIX-4207 [2-[4-[[1-[[3,5-bis(1,1-dimethylethyl)-4-hydroxyphenyl]thio]-1-methylethyl]thio]-2,6-bis(1,1-dimethylethyl)phenoxy]acetic acid], a novel antioxidant and anti-inflammatory compound: cellularand biochemical characterization of antioxidant activity and inhibition of redox-sensitive inflammatory gene expression. J Pharmacol Exp Ther. 2005 May;313(2):492-501. Epub 2005 Feb 8. | ||||
| Ref 527709 | TNFerade, an adenovector carrying the transgene for human tumor necrosis factor alpha, for patients with advanced solid tumors: surgical experience and long-term follow-up. Ann Surg Oncol. 2005 Oct;12(10):825-30. Epub 2005 Aug 9. | ||||
| Ref 529415 | Diabetes-enhanced tumor necrosis factor-alpha production promotes apoptosis and the loss of retinal microvascular cells in type 1 and type 2 models of diabetic retinopathy. Am J Pathol. 2008 May;172(5):1411-8. | ||||
| Ref 529663 | Pharmacokinetics and posterior segment biodistribution of ESBA105, an anti-TNF-alpha single-chain antibody, upon topical administration to the rabbit eye. Invest Ophthalmol Vis Sci. 2009 Feb;50(2):771-8. | ||||
| Ref 531164 | Bioorg Med Chem Lett. 2010 Nov 1;20(21):6195-8. Epub 2010 Sep 16.Discovery of the inhibitors of tumor necrosis factor alpha with structure-based virtual screening. | ||||
| Ref 532192 | AP301, a synthetic peptide mimicking the lectin-like domain of TNF, enhances amiloride-sensitive Na(+) current in primary dog, pig and rat alveolar type II cells. Pulm Pharmacol Ther. 2013 Jun;26(3):356-63. | ||||
| Ref 532736 | Biosimilars in the therapy of inflammatory bowel diseases. Eur J Gastroenterol Hepatol. 2014 Jun;26(6):581-7. | ||||
| Ref 532917 | Apoptosis and the FLIP and NF-kappa B proteins as pharmacodynamic criteria for biosimilar TNF-alpha antagonists. Biologics. 2014 Jul 31;8:211-20. | ||||
| Ref 533160 | Population pharmacokinetic analysis of certolizumab pegol in patients with Crohn's disease. J Clin Pharmacol. 2015 Aug;55(8):866-74. | ||||
| Ref 533875 | Effect of the carbocyclic nucleoside analogue MDL 201,112 on inhibition of interferon-gamma-induced priming of Lewis (LEW/N) rat macrophages for enhanced respiratory burst and MHC class II Ia+ antigen expression. J Leukoc Biol. 1994 Aug;56(2):133-44. | ||||
| Ref 534263 | Effect of FR133605, a novel cytokine suppressive agent, on bone and cartilage destruction in adjuvant arthritic rats. J Rheumatol. 1996 Oct;23(10):1778-83. | ||||
| Ref 535084 | A novel anti-rheumatic drug suppresses tumor necrosis factor-alpha and augments interleukin-10 in adjuvant arthritic rats. Eur J Pharmacol. 2000 Dec 15;409(3):331-5. | ||||
| Ref 535681 | RDP58, a locally active TNF inhibitor, is effective in the dextran sulphate mouse model of chronic colitis. Inflamm Res. 2002 Nov;51(11):522-31. | ||||
| Ref 535835 | Tumor necrosis factor alpha in the pathogenesis of cerebral malaria. Cell Mol Life Sci. 2003 Aug;60(8):1623-35. | ||||
| Ref 535981 | Targeted therapies in myelodysplastic syndromes: ASH 2003 review. Semin Hematol. 2004 Apr;41(2 Suppl 4):13-20. | ||||
| Ref 536282 | Identification of a novel boron-containing antibacterial agent (AN0128) with anti-inflammatory activity, for the potential treatment of cutaneous diseases. Bioorg Med Chem Lett. 2006 Dec 1;16(23):5963-7. Epub 2006 Sep 25. | ||||
| Ref 536447 | Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52. | ||||
| Ref 536599 | Inhibition of experimental periodontitis by a topical boron-based antimicrobial. J Dent Res. 2008 Feb;87(2):148-52. | ||||
| Ref 536688 | Drug insight: tumor necrosis factor-converting enzyme as a pharmaceutical target for rheumatoid arthritis. Nat Clin Pract Rheumatol. 2008 Jun;4(6):300-9. Epub 2008 Apr 15. | ||||
| Ref 536993 | Efficacy of different thalidomide regimens for patients with multiple myeloma and its relationship with TNF-alpha level. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2008 Dec;16(6):1312-5. | ||||
| Ref 537129 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | ||||
| Ref 537229 | Thalidomide and thalidomide analogues for maintenance of remission in Crohn's disease. Cochrane Database Syst Rev. 2009 Apr 15;(2):CD007351. | ||||
| Ref 537574 | Adalimumab for psoriasis patients who are non-responders to etanercept: open-label prospective evaluation. J Eur Acad Dermatol Venereol. 2009 Jul 1. | ||||
| Ref 544154 | Phase I and Pharmacokinetic Studies of CYT-6091, a Novel PEGylated Colloidal Gold-rhTNF Nanomedicine. Clin Cancer Res. 2010 December 15; 16(24): 6139-6149. | ||||
| Ref 544230 | Modulation of Anti-Tumor Necrosis Factor Alpha (TNF-alpha) Antibody Secretion in Mice Immunized with TNF-alpha Kinoid. Clin Vaccine Immunol. 2012 May; 19(5): 699-703. | ||||
| Ref 544392 | Case study: biosimilar anti TNFalpha (Adalimumab) analysis of Fc effector functions. BMC Proc. 2013; 7(Suppl 6): P30. | ||||
| Ref 544452 | Therapeutic Vaccination with TNF-Kinoid in TNF Antagonist-Resistant Rheumatoid Arthritis: A Phase II Randomized, Controlled Clinical Trial. PLoS One. 2014; 9(12): e113465. | ||||
| Ref 549168 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033173) | ||||
| Ref 550134 | US patent application no. 8007,790, Methods for treating polycystic kidney disease (pkd) or other cyst forming diseases. | ||||
| Ref 550185 | IND Filed for AME-527, Monoclonal Antibody That Is a Potential Treatment for Rheumatoid Arthritis. P&T Community. 2015. | ||||
| Ref 551126 | CombinatoRx Drug Candidate CRx-191 Demonstrates Positive Phase 2 Results In Psoriasis. CombinatoRx. 2008. | ||||
| Ref 551129 | Anacor Announces Positive Results From Phase 2 Trial Of Novel Anti-Inflammatory Agent For The Treatment Of Atopic Dermatitis. Anacor Pharmaceuticals. Friday 16 June 2006. | ||||
| Ref 551903 | US patent application no. 2008,0269,123, Methods for treating polycystic kidney disease (pkd) or other cyst forming diseases. | ||||
| Ref 889442 | Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801. doi: 10.1038/nrd4478. | ||||
| Ref 889443 | The potential of biologics for the treatment of asthma. Nat Rev Drug Discov. 2012 Dec;11(12):958-72. doi: 10.1038/nrd3792. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

