Target General Infomation
Target ID
T20761
Former ID
TTDNS00542
Target Name
Vascular endothelial growth factor A
Gene Name
VEGFA
Synonyms
VEGF-A; Vascular permeability factor; VPF; VEGFA
Target Type
Successful
Disease Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21]
Exudative age-related macular degeneration [ICD9: 362.5; ICD10: H35.3]
Lateral sclerosis [ICD10: G12.2]
Macular degeneration [ICD9: 362.5; ICD10: H35.3]
Metastatic colorectal cancer [ICD9: 153, 154; ICD10: C18-C21]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. .
BioChemical Class
PDGF VEGF growth factor
UniProt ID
Sequence
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Drugs and Mode of Action
Drug(s) Aflibercept Drug Info Approved Metastatic colorectal cancer [551871]
PTC299 Drug Info Phase 2 Solid tumours [522680]
RG7221 Drug Info Phase 2 Colorectal cancer [549449]
RO5520985 Drug Info Phase 2 Colorectal cancer [889398]
SNN-0029 Drug Info Phase 1/2 Lateral sclerosis [523531]
MP-0112 Drug Info Phase 1 Macular degeneration [522910]
SFLT-01 Drug Info Phase 1 Macular degeneration [522879]
Bevasiranib Drug Info Discontinued in Phase 3 Exudative age-related macular degeneration [550053]
Modulator Aflibercept Drug Info [551871]
Bevasiranib Drug Info
PTC299 Drug Info
RG7221 Drug Info
RO5520985 Drug Info [889442]
SFLT-01 Drug Info [531341]
SNN-0029 Drug Info [551420]
Inhibitor MP-0112 Drug Info [532834]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Pancreatic cancer
Bladder cancer
Rheumatoid arthritis
NetPath Pathway IL2 Signaling Pathway
EGFR1 Signaling Pathway
TGF_beta_Receptor Signaling Pathway
TSH Signaling Pathway
Leptin Signaling Pathway
FSH Signaling Pathway
PANTHER Pathway Angiogenesis
VEGF signaling pathway
Pathway Interaction Database Glypican 1 network
HIF-2-alpha transcription factor network
Beta3 integrin cell surface interactions
S1P3 pathway
Signaling events mediated by TCPTP
S1P1 pathway
Alpha9 beta1 integrin signaling events
Integrins in angiogenesis
VEGFR1 specific signals
HIF-1-alpha transcription factor network
Reactome Platelet degranulation
Regulation of gene expression by Hypoxia-inducible Factor
VEGF ligand-receptor interactions
VEGF binds to VEGFR leading to receptor dimerization
WikiPathways SIDS Susceptibility Pathways
Hypertrophy Model
Endochondral Ossification
Focal Adhesion
Differentiation Pathway
Bladder Cancer
Regulation of Hypoxia-inducible Factor (HIF) by Oxygen
Nifedipine Activity
Aryl Hydrocarbon Receptor
Quercetin and Nf-kB/ AP-1 Induced Cell Apoptosis
Integrated Pancreatic Cancer Pathway
Oncostatin M Signaling Pathway
Allograft Rejection
Integrated Breast Cancer Pathway
Signaling by VEGF
Heart Development
Angiogenesis
References
Ref 522680ClinicalTrials.gov (NCT00911248) PTC299 for Treatment of Neurofibromatosis Type 2. U.S. National Institutes of Health.
Ref 522879ClinicalTrials.gov (NCT01024998) Safety and Tolerability Study of AAV2-sFLT01 in Patients With Neovascular Age-Related Macular Degeneration (AMD). U.S. National Institutes of Health.
Ref 522910ClinicalTrials.gov (NCT01042678) Study of MP0112 Intravitreal Injection in Patients With Diabetic Macular Edema. U.S. National Institutes of Health.
Ref 523531ClinicalTrials.gov (NCT01384162) An Open Label, Safety and Tolerability Continuation Study of Intracerebroventricular Administration of sNN0029 to Patients With Amyotrophic Lateral Sclerosis. U.S. National Institutes of Health.
Ref 549449Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800037469)
Ref 5500532011 Pipeline of Acuity Pharmaceuticals.
Ref 550216Clinical pipeline report, company report or official report of Affitech (2011).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 889398ClinicalTrials.gov (NCT02141295) A Study Comparing the Efficacy and Safety of Vanucizumab and FOLFOX With Bevacizumab and FOLFOX in Participants With Untreated Metastatic Colorectal Cancer
Ref 531341sFLT01: a novel fusion protein with antiangiogenic activity. Mol Cancer Ther. 2011 Mar;10(3):404-15.
Ref 532834Treatment of exudative age-related macular degeneration with a designed ankyrin repeat protein that binds vascular endothelial growth factor: a phase I/II study. Am J Ophthalmol. 2014 Oct;158(4):724-732.e2.
Ref 550216Clinical pipeline report, company report or official report of Affitech (2011).
Ref 551420Clinical pipeline report, company report or official report of Neuronova.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 889442Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801. doi: 10.1038/nrd4478.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.