Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T21960
|
||||
| Former ID |
TTDC00210
|
||||
| Target Name |
Angiopoietin-2
|
||||
| Gene Name |
ANGPT2
|
||||
| Synonyms |
ANG-2; ANGPT2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Binds to TEK/TIE2, competing for the ANGPT1 bindingsite, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
|
||||
| BioChemical Class |
Fibrinogen
|
||||
| Target Validation |
T21960
|
||||
| UniProt ID | |||||
| Sequence |
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE INKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVN NSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTL TFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFV SQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPG NDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGS GYSLKATTMMIRPADF |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | AMG 386 | Drug Info | Phase 3 | Breast cancer | [523327], [543118] |
| RG7221 | Drug Info | Phase 2 | Colorectal cancer | [549449] | |
| RO5520985 | Drug Info | Phase 2 | Colorectal cancer | [889398] | |
| CVX-060 | Drug Info | Phase 1/2 | Solid tumours | [550567] | |
| CVX-241 | Drug Info | Phase 1 | Cancer | [544157] | |
| MEDI-3617 | Drug Info | Phase 1 | Solid tumours | [548917] | |
| REGN-910 | Drug Info | Phase 1 | Solid tumours | [523314] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Ras signaling pathway | ||||
| Rap1 signaling pathway | |||||
| HIF-1 signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
| PANTHER Pathway | Angiogenesis | ||||
| Pathway Interaction Database | Angiopoietin receptor Tie2-mediated signaling | ||||
| Reactome | Tie2 Signaling | ||||
| WikiPathways | Cell surface interactions at the vascular wall | ||||
| References | |||||
| Ref 523314 | ClinicalTrials.gov (NCT01271972) Study of Nesvacumab (REGN910/ SAR307746). U.S. National Institutes of Health. | ||||
| Ref 523327 | ClinicalTrials.gov (NCT01281254) TRINOVA-2: Trebananib in Ovarian Cancer-2. U.S. National Institutes of Health. | ||||
| Ref 543118 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8414). | ||||
| Ref 544157 | Chemical generation of bispecific antibodies. Proc Natl Acad Sci U S A. 2010 December 28; 107(52): 22611-22616. | ||||
| Ref 548917 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030291) | ||||
| Ref 531798 | MEDI3617, a human anti-angiopoietin 2 monoclonal antibody, inhibits angiogenesis and tumor growth in human tumor xenograft models. Int J Oncol. 2012 May;40(5):1321-30. | ||||
| Ref 532117 | Angiopoietin-2 functions as a Tie2 agonist in tumor models, where it limits the effects of VEGF inhibition. Cancer Res. 2013 Jan 1;73(1):108-18. | ||||
| Ref 544157 | Chemical generation of bispecific antibodies. Proc Natl Acad Sci U S A. 2010 December 28; 107(52): 22611-22616. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

