Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T22839
|
||||
| Former ID |
TTDR00230
|
||||
| Target Name |
Elastase 1
|
||||
| Gene Name |
CELA1
|
||||
| Synonyms |
Elastase; CELA1
|
||||
| Target Type |
Successful
|
||||
| Disease | Alpha-1 antitrypsin deficiency [ICD9: 273.4; ICD10: E88.0] | ||||
| Bronchitis [ICD10: J20-J21, J42] | |||||
| Cystic fibrosis [ICD9: 277; ICD10: E84] | |||||
| Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
| Emphysema [ICD9: 492; ICD10: J43] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Function |
Acts upon elastin.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T22839
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.21.36
|
||||
| Sequence |
MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMT
AAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQS VTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSS YWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTV FTQVSAYISWINNVIASN |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Alpha 1-PI | Drug Info | Approved | Alpha-1 antitrypsin deficiency | [545546], [551871] |
| Erdosteine | Drug Info | Approved | Bronchitis | [551871] | |
| Sivelestat | Drug Info | Phase 4 | Discovery agent | [521724], [541582] | |
| Mdl 101,146 | Drug Info | Terminated | Inflammatory disease | [546375] | |
| PBI-1101 | Drug Info | Terminated | Inflammatory disease | [547638] | |
| SSR-69071 | Drug Info | Terminated | Chronic obstructive pulmonary disease | [547262] | |
| SYN-1134 | Drug Info | Terminated | Cystic fibrosis | [547708] | |
| WIN-63759 | Drug Info | Terminated | Emphysema | [546320] | |
| Inhibitor | (2-BROMOETHYL)(2-'FORMYL-4'-AMINOPHENYL) ACETATE | Drug Info | [551374] | ||
| (Tert-Butyloxycarbonyl)-Alanyl-Alanyl-Amine | Drug Info | [551393] | |||
| Acetate Ion | Drug Info | [551393] | |||
| Acetyl-Ala-Ala-Pro-Ala-trifluromethane | Drug Info | [532036] | |||
| Acetyl-Pro-Ala-Pro-Ala-trifluoro methane | Drug Info | [532036] | |||
| Alpha 1-PI | Drug Info | [535306] | |||
| Dimethylformamide | Drug Info | [551397] | |||
| GRASSYSTATIN A | Drug Info | [530345] | |||
| Mdl 101,146 | Drug Info | [551393] | |||
| MOLASSAMIDE | Drug Info | [530586] | |||
| Para-Isopropylaniline | Drug Info | [551393] | |||
| PBI-1101 | Drug Info | [550871] | |||
| Sivelestat | Drug Info | [537405] | |||
| SSR-69071 | Drug Info | [531528] | |||
| SYN-1134 | Drug Info | [550874] | |||
| Modulator | Erdosteine | Drug Info | [551871] | ||
| WIN-63759 | Drug Info | [550030] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| References | |||||
| Ref 521724 | ClinicalTrials.gov (NCT00219375) Study of Sivelestat Sodium Hydrate in Acute Lung Injury (ALI) Associated With Systemic Inflammatory Response Syndrome (SIRS) in Japan. U.S. National Institutes of Health. | ||||
| Ref 541582 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6441). | ||||
| Ref 545546 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003666) | ||||
| Ref 546320 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007449) | ||||
| Ref 546375 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007771) | ||||
| Ref 547262 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014569) | ||||
| Ref 547638 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018032) | ||||
| Ref 530345 | J Med Chem. 2009 Sep 24;52(18):5732-47.Grassystatins A-C from marine cyanobacteria, potent cathepsin E inhibitors that reduce antigen presentation. | ||||
| Ref 530586 | J Nat Prod. 2010 Mar 26;73(3):459-62.Molassamide, a depsipeptide serine protease inhibitor from the marine cyanobacterium Dichothrix utahensis. | ||||
| Ref 531528 | Pivotal role for alpha1-antichymotrypsin in skin repair. J Biol Chem. 2011 Aug 19;286(33):28889-901. | ||||
| Ref 532036 | J Med Chem. 1990 Jan;33(1):394-407.Synthesis of peptidyl fluoromethyl ketones and peptidyl alpha-keto esters as inhibitors of porcine pancreatic elastase, human neutrophil elastase, and rat and humanneutrophil cathepsin G. | ||||
| Ref 537405 | Sivelestat (selective neutrophil elastase inhibitor) improves the mortality rate of sepsis associated with both ARDS and DIC patients. Shock. 2009 May 18. | ||||
| Ref 550030 | Biological activity of WIN 63759, an orally bioavailable inhibitor of human neutrophil elastase. Drug Development Research Volume 34, Issue 3, pages 306-316, March 1995. | ||||
| Ref 550871 | CN patent application no. 1813706, Use of elastic protease inhibitor for preparing medicine for protecting cerebral hemorrhage. | ||||
| Ref 550874 | EP patent application no. 1292314, Method for treating respiratory disorders associated with pulmonary elastic fiber injury comprising the use of glycosaminoglycans. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

