Target General Infomation
Target ID
T25703
Former ID
TTDC00134
Target Name
Heme oxygenase
Gene Name
HMOX1
Synonyms
HO-1; Heme Oxygenase-1; HMOX1
Target Type
Clinical Trial
Disease Neonatal hyperbilirubinemia; Jaundice [ICD9: 773, 774, 782.4; ICD10: P58, P59, R17]
Function
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
BioChemical Class
Oxidoreductases acting on paired donors
Target Validation
T25703
UniProt ID
EC Number
EC 1.14.99.3
Sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
Structure
1N3U; 1N45; 1NI6; 1OYK; 1OYL; 1OZE; 1OZL; 1OZR; 1OZW; 1S13; 1S8C; 1T5P; 1TWN; 1TWR; 1XJZ; 1XK0; 1XK1; 1XK2; 1XK3; 3CZY; 3HOK; 3K4F; 3TGM
Drugs and Mode of Action
Drug(s) Stannsoporfin Drug Info Phase 2 Neonatal hyperbilirubinemia; Jaundice [524340]
Inhibitor 1-(adamantan-1-yl)-2-(1H-imidazol-1-yl)ethanone Drug Info [551374]
12-Phenylheme Drug Info [551393]
2-Phenylheme Drug Info [551393]
2-Propanol, Isopropanol Drug Info [551393]
Biliverdine Ix Alpha Drug Info [551393]
Formic Acid Drug Info [551393]
Heme Drug Info [551374]
Stannsoporfin Drug Info [536043]
Tin protoporphyrin Drug Info [535305]
Verdoheme Drug Info [551391]
Pathways
BioCyc Pathway Heme degradation
KEGG Pathway Porphyrin and chlorophyll metabolism
HIF-1 signaling pathway
Mineral absorption
MicroRNAs in cancer
Pathway Interaction Database Validated transcriptional targets of AP1 family members Fra1 and Fra2
HIF-1-alpha transcription factor network
PathWhiz Pathway Porphyrin Metabolism
Reactome Iron uptake and transport
WikiPathways Oxidative Stress
Transcriptional activation by NRF2
NRF2 pathway
Nuclear Receptors Meta-Pathway
miR-targeted genes in squamous cell - TarBase
miR-targeted genes in muscle cell - TarBase
miR-targeted genes in lymphocytes - TarBase
miR-targeted genes in leukocytes - TarBase
miR-targeted genes in epithelium - TarBase
References
Ref 524340ClinicalTrials.gov (NCT01887327) Study Evaluating the Safety and Efficacy of Two Doses of Stannsoporfin in Combination With Phototherapy in Neonates With Hyperbilirubinemia. U.S. National Institutes of Health.
Ref 535305Adenovirus-mediated heme oxygenase-1 gene delivery inhibits injury-induced vascular neointima formation. Circulation. 2001 Nov 27;104(22):2710-5.
Ref 536043Chemoprevention of severe neonatal hyperbilirubinemia. Semin Perinatol. 2004 Oct;28(5):365-8.
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 551391DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.