Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T29960
|
||||
| Former ID |
TTDR00688
|
||||
| Target Name |
Wilms' tumor protein
|
||||
| Gene Name |
WT1
|
||||
| Synonyms |
WT1 protein; WT33; Wilms' tumour 1 protein; WT1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Acute myeloid leukemia; Lung cancer [ICD9:205, 162; ICD10: C92.0, C33-C34] | ||||
| Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Myeloid leukemia [ICD9: 208.9; ICD10: C92] | |||||
| Function |
Potential role in transcriptional regulation. Recognizes and binds to the dna sequence 5'-cgcccccgc-3'.
|
||||
| BioChemical Class |
EGR C2H2-type zinc-finger
|
||||
| UniProt ID | |||||
| Sequence |
MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAP
PPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQA SSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHED PMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ MNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDC ERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS CQKKFARSDELVRHHNMHQRNMTKLQLAL |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Combined PR1/WT1 vaccine | Drug Info | Phase 2 | Myeloid leukemia | [533145] |
| DNA vaccine | Drug Info | Phase 2 | Acute myeloid leukemia | [523425] | |
| FPI-01 | Drug Info | Phase 2 | Acute myeloid leukemia | [549553] | |
| WT1 peptide vaccine | Drug Info | Phase 2 | Leukemia | [523307] | |
| WT1-targeted autologous dendritic cell vaccine | Drug Info | Phase 2 | Acute myeloid leukemia | [524053] | |
| WT-4869 | Drug Info | Phase 1/2 | Leukemia | [549182] | |
| GSK-2130579A | Drug Info | Phase 1 | Acute myeloid leukemia | [522918] | |
| INNO-305 | Drug Info | Phase 1 | Acute myeloid leukemia; Lung cancer | [548250] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Transcriptional misregulation in cancer | ||||
| NetPath Pathway | FSH Signaling Pathway | ||||
| IL5 Signaling Pathway | |||||
| Pathway Interaction Database | p73 transcription factor network | ||||
| Regulation of Telomerase | |||||
| WikiPathways | Primary Focal Segmental Glomerulosclerosis FSGS | ||||
| Integrated Pancreatic Cancer Pathway | |||||
| References | |||||
| Ref 522918 | ClinicalTrials.gov (NCT01051063) Evaluation of a New Anti-cancer Immunotherapy in Adult Acute Myeloid Leukemia Patients With a Suboptimal Clinical Response to Induction Chemotherapy. U.S. National Institutes of Health. | ||||
| Ref 523307 | ClinicalTrials.gov (NCT01266083) Trial of a WT-1 Analog Peptide Vaccine in Patients With Acute Myeloid Leukemia (AML) or Acute Lymphoblastic Leukemia (ALL). U.S. National Institutes of Health. | ||||
| Ref 523425 | ClinicalTrials.gov (NCT01334060) WT1 Immunity Via DNA Fusion Gene Vaccination in Haematological Malignancies by Intramuscular Injection Followed by Intramuscular Electroporation. U.S. National Institutes of Health. | ||||
| Ref 524053 | ClinicalTrials.gov (NCT01686334) Efficacy Study of Dendritic Cell Vaccination in Patients With Acute Myeloid Leukemia in Remission. U.S. National Institutes of Health. | ||||
| Ref 533145 | Review of the Results of WT1 Peptide Vaccination Strategies for Myelodysplastic Syndromes and Acute Myeloid Leukemia from Nine Different Studies. Front Immunol. 2015 Feb 4;6:36. | ||||
| Ref 548250 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023753) | ||||
| Ref 524053 | ClinicalTrials.gov (NCT01686334) Efficacy Study of Dendritic Cell Vaccination in Patients With Acute Myeloid Leukemia in Remission. U.S. National Institutes of Health. | ||||
| Ref 529050 | Leukemia-associated antigen-specific T-cell responses following combined PR1 and WT1 peptide vaccination in patients with myeloid malignancies. Blood. 2008 Jan 1;111(1):236-42. Epub 2007 Sep 17. | ||||
| Ref 531614 | Wilms' tumor protein 1 (WT1) peptide vaccination in AML patients: predominant TCR CDR3beta sequence associated with remission in one patient is detectable in other vaccinated patients. Cancer ImmunolImmunother. 2012 Mar;61(3):313-22. | ||||
| Ref 548249 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023753) | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

