Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T31391
|
||||
| Former ID |
TTDS00093
|
||||
| Target Name |
Dipeptidyl peptidase IV
|
||||
| Gene Name |
DPP4
|
||||
| Synonyms |
ADABP; ADCP2; Adenosine deaminase complexing protein 2; Adenosine deaminase complexing protein-2; CD26; DPP 4; DPP IV; DPP-IV; Dipeptidyl peptidase 4; Dipeptidyl peptidase 4 soluble form; Dipeptidyl peptidase IV; T-cell activation antigen CD26; TP103; Tcell activation antigen CD26; DPP4
|
||||
| Target Type |
Successful
|
||||
| Disease | Autism [ICD9: 299; ICD10: F84.0] | ||||
| Autoimmune diabetes [ICD10: E08-E13] | |||||
| Bone marrow transplantation [ICD9: 279.5, 996; ICD10: D89.8, T86] | |||||
| Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | |||||
| Hypoglycemia [ICD9: 250.8, 251.0, 251.1, 251.2, 270.3, 775.6, 962.3; ICD10: E16.0-E16.2] | |||||
| Hematological malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Metabolic disorders [ICD9: 270-279; ICD10: E70-E89] | |||||
| Non-insulin dependent diabetes [ICD10: E11.9] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF- kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotionof lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T31391
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.14.5
|
||||
| Sequence |
MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL
RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL PSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF YSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS EPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY TLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKY PLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS KALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Alogliptin | Drug Info | Approved | Type 2 diabetes | [532651], [541465] |
| Anagliptin | Drug Info | Approved | Type 2 diabetes | [525047], [551871] | |
| Dapagliflozin Propanediol; Saxagliptin Hydrochloride | Drug Info | Approved | Type 2 diabetes | [889446] | |
| Kombiglyze XR/Komboglyze FDC | Drug Info | Approved | Diabetes | [550298] | |
| Linagliptin | Drug Info | Approved | Type 2 diabetes | [541464], [551882] | |
| Saxagliptin | Drug Info | Approved | Type 2 diabetes | [530677], [541462] | |
| Sitagliptin | Drug Info | Approved | Type 2 diabetes | [528715], [538583], [541437] | |
| Vildagliptin | Drug Info | Approved | Type 2 diabetes | [537022], [541460] | |
| Dutogliptin | Drug Info | Phase 3 | Type 2 diabetes | [522338] | |
| Gemigliptin | Drug Info | Phase 3 | Diabetes | [524534] | |
| IDDBCP161883 | Drug Info | Phase 3 | Type 2 diabetes | [524219] | |
| LC-150444 | Drug Info | Phase 3 | Type 2 diabetes | [524679] | |
| MK-3102 | Drug Info | Phase 3 | Type 2 diabetes | [524091], [543109] | |
| SAND-26 | Drug Info | Phase 3 | Autoimmune diabetes | [525143], [543248] | |
| SaxaDapa FDC | Drug Info | Phase 3 | Diabetes | [530967], [531182] | |
| SYR-472 | Drug Info | Phase 3 | Metabolic disorders | [551987] | |
| Denagliptin | Drug Info | Phase 2/3 | Type 2 diabetes | [521900] | |
| IP10 C8 | Drug Info | Phase 2 | Psoriasis | [530043] | |
| IP10.C8-1 | Drug Info | Phase 2 | Psoriasis | [530043] | |
| KRP-104 | Drug Info | Phase 2 | Type 2 diabetes | [522106] | |
| Melogliptin | Drug Info | Phase 2 | Type 2 diabetes | [548067] | |
| P32/98 | Drug Info | Phase 2 | Autism | [535416] | |
| PF-00734200 | Drug Info | Phase 2 | Type 2 diabetes | [522028], [542437] | |
| YSCMA | Drug Info | Phase 1/2 | Hematological malignancies | [548989] | |
| ARI-2243 | Drug Info | Phase 1 | Type 2 diabetes | [548767] | |
| DA-1229 | Drug Info | Phase 1 | Type 2 diabetes | [522762] | |
| Teneligliptin | Drug Info | Phase 1 | Type 2 diabetes | [525204] | |
| ASP8497 | Drug Info | Preclinical | Type 2 diabetes | [529465] | |
| ER-319711-15 | Drug Info | Preclinical | Type 2 diabetes | [528437] | |
| LY-2463665 | Drug Info | Preclinical | Type 2 diabetes | [532031] | |
| ALS 2-0426 | Drug Info | Discontinued in Phase 2 | Type 2 diabetes | [548136] | |
| Isoleucine thiazolidide DPP IV | Drug Info | Discontinued in Phase 2 | Type 2 diabetes | [547229] | |
| NVP-DPP728 | Drug Info | Discontinued in Phase 2 | Type 2 diabetes | [547061] | |
| PSN-9301 | Drug Info | Discontinued in Phase 2 | Diabetes | [547754] | |
| R-1438 | Drug Info | Discontinued in Phase 2 | Type 2 diabetes | [547657] | |
| TA-6666 | Drug Info | Discontinued in Phase 2 | Type 2 diabetes | [547979] | |
| ABT-279 | Drug Info | Discontinued in Phase 1 | Type 2 diabetes | [548377] | |
| SSR-162369 | Drug Info | Discontinued in Phase 1 | Type 2 diabetes | [548129] | |
| TAK-100 | Drug Info | Discontinued in Phase 1 | Diabetes | [548755] | |
| DSP-7238 | Drug Info | Terminated | Diabetes | [548770] | |
| PT-630 | Drug Info | Terminated | Type 2 diabetes | [548125] | |
| Inhibitor | (+/-)-6-(2-chlorophenyl)cyclohex-3-enamine | Drug Info | [528488] | ||
| (1-phenylcyclopentyl)methanamine | Drug Info | [527902] | |||
| (1R,2R)-1,2-diphenylethane-1,2-diamine | Drug Info | [527902] | |||
| (1R,2S)-1,2-diphenylethane-1,2-diamine | Drug Info | [527902] | |||
| (2-(2-chlorophenyl)pyridin-3-yl)methanamine | Drug Info | [527902] | |||
| (2-chloro-6-phenoxyphenyl)methanamine | Drug Info | [527902] | |||
| (2s)-Pyrrolidin-2-Ylmethylamine | Drug Info | [551391] | |||
| (3S,4R)-3-butyl-1-phenylpiperidin-4-amine | Drug Info | [528776] | |||
| (5-phenyl-3H-benzo[d]imidazol-4-yl)methanamine | Drug Info | [529379] | |||
| (R)-1-(2-aminoacetyl)pyrrolidin-2-ylboronic acid | Drug Info | [529685] | |||
| (S)-2-Amino-1-azetidin-1-yl-2-cyclohexyl-ethanone | Drug Info | [527697] | |||
| (S)-2-Amino-1-thiazolidin-3-yl-propane-1-thione | Drug Info | [526431] | |||
| (S)-pyrrolidin-1-yl(pyrrolidin-2-yl)methanone | Drug Info | [529175] | |||
| (S)-pyrrolidin-2-yl(thiazolidin-3-yl)methanone | Drug Info | [528694] | |||
| 1-(1-phenylcyclopentyl)methylamine | Drug Info | [551374] | |||
| 1-benzhydryl-3-butylpiperidin-4-amine | Drug Info | [528776] | |||
| 1-benzyl-4-(2,4-dichlorophenyl)pyrrolidin-3-amine | Drug Info | [528652] | |||
| 1-biphenyl-2-ylmethanamine | Drug Info | [551374] | |||
| 2-(2-chlorophenyl)-2-morpholinoethanamine | Drug Info | [527902] | |||
| 2-Amino-3-Methyl-1-Pyrrolidin-1-Yl-Butan-1-One | Drug Info | [551393] | |||
| 3-butyl-1-(naphthalen-1-yl)piperidin-4-amine | Drug Info | [528776] | |||
| 4-(2,4-dichlorophenyl)-1-phenylpyrrolidin-3-amine | Drug Info | [528652] | |||
| 4-(2,4-dichlorophenyl)-1-tosylpyrrolidin-3-amine | Drug Info | [528652] | |||
| 4-iodophenyl-alaninyl-(S)-2-cyano-pyrrolidine | Drug Info | [527808] | |||
| ABT-279 | Drug Info | [537022] | |||
| ABT-341 | Drug Info | [528488] | |||
| Alogliptin | Drug Info | [537022], [537230], [551717] | |||
| Alpha-D-Mannose | Drug Info | [551393] | |||
| ALS 2-0426 | Drug Info | [550054] | |||
| ASC-201 | Drug Info | [543447] | |||
| ASP8497 | Drug Info | [537022] | |||
| BPI-711001 | Drug Info | [543447] | |||
| C-(2'-Chloro-biphenyl-2-yl)-methylamine | Drug Info | [527902] | |||
| compound 1 (Xiao et al. 2014) | Drug Info | [543447] | |||
| compound 24dd | Drug Info | [531081] | |||
| Cyclohexylglycine-(2S)-cyanopyrrolidine | Drug Info | [527953] | |||
| D-420720 | Drug Info | [543447] | |||
| D-Val-L-boroPro | Drug Info | [528804] | |||
| DA-1229 | Drug Info | [531687] | |||
| DB-160 | Drug Info | [543447] | |||
| Denagliptin | Drug Info | [537022] | |||
| Diisopropylphosphono Group | Drug Info | [551393] | |||
| Dipeptidyl peptidase IV inhibitors | Drug Info | [543447] | |||
| DIPROTIN A | Drug Info | [529207] | |||
| DPP-IV inhibitors | Drug Info | [543447] | |||
| DPP-IV inhibitors | Drug Info | [543447] | |||
| DPP-IV inhibitors | Drug Info | [543447] | |||
| DSP-7238 | Drug Info | [543447] | |||
| Dutogliptin | Drug Info | [530838] | |||
| EMC-0901 | Drug Info | [543447] | |||
| ER-319711-15 | Drug Info | [537022] | |||
| FE 999011 | Drug Info | [535438] | |||
| Fucose | Drug Info | [551393] | |||
| Gemigliptin | Drug Info | [533009] | |||
| IDDBCP161883 | Drug Info | [532352], [537022] | |||
| Iodo-Phenylalanine | Drug Info | [551393] | |||
| IP10.C8-1 | Drug Info | [522549], [530043] | |||
| Isoleucine thiazolidide DPP IV | Drug Info | [537022] | |||
| KR-62436 | Drug Info | [529964] | |||
| L-Ala-L-boroPro | Drug Info | [528804] | |||
| L-Val-L-boroPro | Drug Info | [528804] | |||
| LC-150444 | Drug Info | [550262] | |||
| Linagliptin | Drug Info | [537022], [550386] | |||
| LY-2463665 | Drug Info | [537022] | |||
| Melogliptin | Drug Info | [537022] | |||
| N-alkyl Gly-boro-Pro derivative | Drug Info | [527678] | |||
| N-isoleucylthiazolidine | Drug Info | [527953] | |||
| N4-(4-chlorobenzyl)-2,4-diaminobutanoylpiperidine | Drug Info | [528314] | |||
| NVP-DPP728 | Drug Info | [529262] | |||
| P32/98 | Drug Info | [535416] | |||
| PK-44 | Drug Info | [543447] | |||
| PSN-9301 | Drug Info | [544485] | |||
| R-1438 | Drug Info | [537022] | |||
| Retagliptin | Drug Info | [543447] | |||
| Saxagliptin | Drug Info | [530677], [537022], [550288] | |||
| Sitagliptin | Drug Info | [535810], [535813], [537022], [537506] | |||
| SSR-162369 | Drug Info | [537022] | |||
| SYR-472 | Drug Info | [532703], [551717] | |||
| TA-6666 | Drug Info | [549776] | |||
| TAK-100 | Drug Info | [551717] | |||
| TRC-8XXX series | Drug Info | [543447] | |||
| Trelagliptin Succinate | Drug Info | [543447] | |||
| Vildagliptin | Drug Info | [537022] | |||
| Modulator | Anagliptin | Drug Info | [544067] | ||
| ARI-2243 | Drug Info | [544150] | |||
| Dapagliflozin Propanediol; Saxagliptin Hydrochloride | Drug Info | [556264] | |||
| E-3024 | Drug Info | ||||
| IP10 C8 | Drug Info | [530043] | |||
| Kombiglyze XR/Komboglyze FDC | Drug Info | [543447] | |||
| KRP-104 | Drug Info | [550202] | |||
| MK-3102 | Drug Info | [532717] | |||
| PF-00734200 | Drug Info | ||||
| PT-630 | Drug Info | [556264] | |||
| SaxaDapa FDC | Drug Info | [530967], [531182] | |||
| Teneligliptin | Drug Info | [543447] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Protein digestion and absorption | ||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| TGF_beta_Receptor Signaling Pathway | |||||
| References | |||||
| Ref 521900 | ClinicalTrials.gov (NCT00387972) Study Of Denagliptin In Subjects With Type 2 Diabetes Mellitus (T2DM). U.S. National Institutes of Health. | ||||
| Ref 522028 | ClinicalTrials.gov (NCT00473525) 12 Week Study Of PF-00734200 For The Treatment Of Type 2 Diabetes Mellitus In Subjects Treated With Metformin. U.S. National Institutes of Health. | ||||
| Ref 522106 | ClinicalTrials.gov (NCT00525330) A Randomized, Double-Blind, Placebo-Controlled Study to Assess the Safety and Efficacy of KRP-104 in Patients With Type 2 Diabetes Inadequately Controlled on Metformin Alone. U.S. National Institutes of Health. | ||||
| Ref 522338 | ClinicalTrials.gov (NCT00690638) Safety and Efficacy Study of Dutogliptin/PHX1149T to Treat Type 2 Diabetes Mellitus. U.S. National Institutes of Health. | ||||
| Ref 522762 | ClinicalTrials.gov (NCT00961025) A Study to Characterize the Pharmacokinetics/Pharmacodynamics and Effect of Food of DA-1229 in Healthy Male Subjects. U.S. National Institutes of Health. | ||||
| Ref 524091 | ClinicalTrials.gov (NCT01703208) A Study to Assess Cardiovascular Outcomes Following Treatment With MK-3102 in Participants With Type 2 Diabetes Mellitus (MK-3102-018). U.S. National Institutes of Health. | ||||
| Ref 524219 | ClinicalTrials.gov (NCT01798238) Teneligliptin(MP-513) Versus Placebo in Type 2 Diabetes Mellitus. U.S. National Institutes of Health. | ||||
| Ref 524534 | ClinicalTrials.gov (NCT01990469) Efficacy and Safety of Gemigliptin 50mg qd Added in Patients With Type 2 Diabetes Inadequately Controlled on Glimepiride and Metformin. U.S. National Institutes of Health. | ||||
| Ref 524679 | ClinicalTrials.gov (NCT02089126) Phase III Trial to Evaluate the Efficacy and Safety of Gemigliptin 50mg qd Added to Ongoing Glimepiride as Fix-dose Combination in Patients With Type 2 Diabetes. U.S.National Institutes of Health. | ||||
| Ref 525047 | ClinicalTrials.gov (NCT02330406) Randomized Evaluation of Anagliptin Versus Sitagliptin On Low-density lipoproteiN Cholesterol in Diabetes Trial. U.S. National Institutes of Health. | ||||
| Ref 525143 | ClinicalTrials.gov (NCT02411084) Study of BEGEDINA vs "Conventional Treatment" for Treating Steroid-Resistant Acute GvHD. U.S. National Institutes of Health. | ||||
| Ref 525204 | ClinicalTrials.gov (NCT02449330) Teneligliptin on the Progressive Left Ventricular Diastolic Dysfunction With Type 2 Diabetes Mellitus Study. | ||||
| Ref 528437 | 7-But-2-ynyl-9-(6-methoxy-pyridin-3-yl)-6-piperazin-1-yl-7,9-dihydro-purin-8-one is a novel competitive and selective inhibitor of dipeptidyl peptidase IV with an antihyperglycemic activity. J Pharmacol Exp Ther. 2006 Dec;319(3):1253-7. Epub 2006 Sep 15. | ||||
| Ref 529465 | ASP8497 is a novel selective and competitive dipeptidyl peptidase-IV inhibitor with antihyperglycemic activity. Biochem Pharmacol. 2008 Jul 1;76(1):98-107. | ||||
| Ref 530043 | Recent insights into the role of dipeptidyl aminopeptidase IV (DPIV) and aminopeptidase N (APN) families in immune functions. Clin Chem Lab Med. 2009;47(3):253-61. | ||||
| Ref 530967 | Saxagliptin: a new dipeptidyl peptidase-4 inhibitor for type 2 diabetes. Cardiol Rev. 2010 Jul-Aug;18(4):213-7. | ||||
| Ref 531182 | The novel sodium glucose transporter 2 inhibitor dapagliflozin sustains pancreatic function and preserves islet morphology in obese, diabetic rats. Diabetes Obes Metab. 2010 Nov;12(11):1004-12. | ||||
| Ref 532031 | Discovery and preclinical profile of teneligliptin (3-[(2S,4S)-4-[4-(3-methyl-1-phenyl-1H-pyrazol-5-yl)piperazin-1-yl]pyrrolidin-2-ylcarbonyl]thiazolidine): a highly potent, selective, long-lasting and orally active dipeptidyl peptidase IV inhibitor for the treatment of type 2 diabetes. Bioorg Med Chem. 2012 Oct 1;20(19):5705-19. | ||||
| Ref 535416 | Long-term treatment with the dipeptidyl peptidase IV inhibitor P32/98 causes sustained improvements in glucose tolerance, insulin sensitivity, hyperinsulinemia, and beta-cell glucose responsiveness in VDF (fa/fa) Zucker rats. Diabetes. 2002 Apr;51(4):943-50. | ||||
| Ref 537022 | Emerging drug candidates of dipeptidyl peptidase IV (DPP IV) inhibitor class for the treatment of Type 2 Diabetes. Curr Drug Targets. 2009 Jan;10(1):71-87. | ||||
| Ref 538583 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 022044. | ||||
| Ref 541437 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6286). | ||||
| Ref 541460 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6310). | ||||
| Ref 541462 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6316). | ||||
| Ref 541464 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6318). | ||||
| Ref 541465 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6319). | ||||
| Ref 542437 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7413). | ||||
| Ref 543109 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8402). | ||||
| Ref 543248 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8691). | ||||
| Ref 547061 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012640) | ||||
| Ref 547229 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014308) | ||||
| Ref 547657 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018193) | ||||
| Ref 547754 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019065) | ||||
| Ref 547979 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020875) | ||||
| Ref 548067 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021640) | ||||
| Ref 548125 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022168) | ||||
| Ref 548129 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022199) | ||||
| Ref 548136 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022304) | ||||
| Ref 548377 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025075) | ||||
| Ref 548755 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028364) | ||||
| Ref 548767 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028500) | ||||
| Ref 548770 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028616) | ||||
| Ref 548989 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031210) | ||||
| Ref 550298 | KOMBIGLYZE? XR tablets approved in the US for the treatment of type 2 diabetes mellitus in adults | ||||
| Ref 522549 | ClinicalTrials.gov (NCT00824980) Combined Inhibition of Dipeptidyl Peptidase IV (DPIV/CD26) and Aminopeptidase N (APN/CD13) in the Treatment of Psoriasis. U.S. National Institutes of Health. | ||||
| Ref 526431 | Bioorg Med Chem Lett. 2002 Oct 21;12(20):2825-8.Development of potent and selective dipeptidyl peptidase II inhibitors. | ||||
| Ref 527678 | Bioorg Med Chem Lett. 2005 Oct 1;15(19):4239-42.Synthesis and structure-activity relationship of N-alkyl Gly-boro-Pro inhibitors of DPP4, FAP, and DPP7. | ||||
| Ref 527697 | Bioorg Med Chem Lett. 2005 Nov 1;15(21):4770-3.New fluorinated pyrrolidine and azetidine amides as dipeptidyl peptidase IV inhibitors. | ||||
| Ref 527808 | Bioorg Med Chem Lett. 2006 Jan 1;16(1):123-8. Epub 2005 Oct 19.Discovery, SAR, and X-ray structure of novel biaryl-based dipeptidyl peptidase IV inhibitors. | ||||
| Ref 527902 | Bioorg Med Chem Lett. 2006 Mar 1;16(5):1405-9.In silico fragment-based discovery of DPP-IV S1 pocket binders. | ||||
| Ref 527953 | J Med Chem. 2006 Jan 12;49(1):373-80.2-[3-[2-[(2S)-2-Cyano-1-pyrrolidinyl]-2-oxoethylamino]-3-methyl-1-oxobutyl]- 1,2,3,4-tetrahydroisoquinoline: a potent, selective, and orally bioavailable dipeptide-derived inhibitor of dipeptidyl peptidase IV. | ||||
| Ref 528314 | Bioorg Med Chem Lett. 2006 Sep 15;16(18):4777-9. Epub 2006 Jul 17.Synthesis and dipeptidyl peptidase inhibition of N-(4-substituted-2,4-diaminobutanoyl)piperidines. | ||||
| Ref 528488 | J Med Chem. 2006 Nov 2;49(22):6439-42.Discovery of ((4R,5S)-5-amino-4-(2,4,5- trifluorophenyl)cyclohex-1-enyl)-(3- (trifluoromethyl)-5,6-dihydro- [1,2,4]triazolo[4,3-a]pyrazin-7(8H)-yl)methanone (ABT-341), a highly potent, selective, orally efficacious, and safe dipeptidyl peptidase IV inhibitor for the treatment of type 2 diabetes. | ||||
| Ref 528652 | Bioorg Med Chem Lett. 2007 Apr 1;17(7):2005-12. Epub 2007 Jan 19.Pyrrolidine-constrained phenethylamines: The design of potent, selective, and pharmacologically efficacious dipeptidyl peptidase IV (DPP4) inhibitors from a lead-like screening hit. | ||||
| Ref 528694 | Bioorg Med Chem Lett. 2007 May 1;17(9):2618-21. Epub 2007 Feb 8.[(S)-gamma-(4-Aryl-1-piperazinyl)-l-prolyl]thiazolidines as a novel series of highly potent and long-lasting DPP-IV inhibitors. | ||||
| Ref 528776 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):2966-70. Epub 2007 Mar 25.1,3-disubstituted 4-aminopiperidines as useful tools in the optimization of the 2-aminobenzo[a]quinolizine dipeptidyl peptidase IV inhibitors. | ||||
| Ref 528804 | J Med Chem. 2007 May 17;50(10):2391-8. Epub 2007 Apr 26.Synthesis and characterization of constrained peptidomimetic dipeptidyl peptidase IV inhibitors: amino-lactam boroalanines. | ||||
| Ref 529175 | Bioorg Med Chem. 2008 Feb 15;16(4):1613-31. Epub 2007 Nov 17.Design and synthesis of DPP-IV inhibitors lacking the electrophilic nitrile group. | ||||
| Ref 529207 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):479-84. Epub 2007 Dec 3.Inhibition of dipeptidyl peptidase-IV (DPP-IV) by atorvastatin. | ||||
| Ref 529262 | Eur J Med Chem. 2008 Aug;43(8):1603-11. Epub 2007 Nov 29.A three-dimensional pharmacophore model for dipeptidyl peptidase IV inhibitors. | ||||
| Ref 529379 | Bioorg Med Chem Lett. 2008 Apr 1;18(7):2362-7. Epub 2008 Mar 4.Structure-based design and synthesis of benzimidazole derivatives as dipeptidyl peptidase IV inhibitors. | ||||
| Ref 529685 | J Med Chem. 2008 Oct 9;51(19):6005-13. Epub 2008 Sep 11.Dipeptide boronic acid inhibitors of dipeptidyl peptidase IV: determinants of potency and in vivo efficacy and safety. | ||||
| Ref 529964 | Bioorg Med Chem. 2009 Mar 1;17(5):1783-802. Epub 2009 Jan 31.Medicinal chemistry approaches to the inhibition of dipeptidyl peptidase-4 for the treatment of type 2 diabetes. | ||||
| Ref 530043 | Recent insights into the role of dipeptidyl aminopeptidase IV (DPIV) and aminopeptidase N (APN) families in immune functions. Clin Chem Lab Med. 2009;47(3):253-61. | ||||
| Ref 530838 | Dutogliptin, a selective DPP4 inhibitor, improves glycaemic control in patients with type 2 diabetes: a 12-week, double-blind, randomized, placebo-controlled, multicentre trial. Diabetes Obes Metab. 2010 Apr;12(4):348-55. | ||||
| Ref 530967 | Saxagliptin: a new dipeptidyl peptidase-4 inhibitor for type 2 diabetes. Cardiol Rev. 2010 Jul-Aug;18(4):213-7. | ||||
| Ref 531081 | Discovery of 6-(aminomethyl)-5-(2,4-dichlorophenyl)-7-methylimidazo[1,2-a]pyrimidine-2-carboxamides as potent, selective dipeptidyl peptidase-4 (DPP4) inhibitors. J Med Chem. 2010 Aug 12;53(15):5620-8. | ||||
| Ref 531182 | The novel sodium glucose transporter 2 inhibitor dapagliflozin sustains pancreatic function and preserves islet morphology in obese, diabetic rats. Diabetes Obes Metab. 2010 Nov;12(11):1004-12. | ||||
| Ref 531687 | DA-1229, a novel and potent DPP4 inhibitor, improves insulin resistance and delays the onset of diabetes. Life Sci. 2012 Jan 2;90(1-2):21-9. | ||||
| Ref 532352 | Teneligliptin: a DPP-4 inhibitor for the treatment of type 2 diabetes. Diabetes Metab Syndr Obes. 2013 May 6;6:187-95. | ||||
| Ref 532663 | Establishment of monoclonal anti-human CD26 antibodies suitable for immunostaining of formalin-fixed tissue. Diagn Pathol. 2014 Feb 6;9:30. | ||||
| Ref 532703 | SYR-472, a novel once-weekly dipeptidyl peptidase-4 (DPP-4) inhibitor, in type 2 diabetes mellitus: a phase 2, randomised, double-blind, placebo-controlled trial. Lancet Diabetes Endocrinol. 2014 Feb;2(2):125-32. | ||||
| Ref 532717 | Omarigliptin (MK-3102): a novel long-acting DPP-4 inhibitor for once-weekly treatment of type 2 diabetes. J Med Chem. 2014 Apr 24;57(8):3205-12. | ||||
| Ref 533009 | Evaluation of the pharmacokinetics of the DPP-4 inhibitor gemigliptin when coadministered with rosuvastatin or irbesartan to healthy subjects. Curr Med Res Opin. 2015 Feb;31(2):229-41. | ||||
| Ref 535416 | Long-term treatment with the dipeptidyl peptidase IV inhibitor P32/98 causes sustained improvements in glucose tolerance, insulin sensitivity, hyperinsulinemia, and beta-cell glucose responsiveness in VDF (fa/fa) Zucker rats. Diabetes. 2002 Apr;51(4):943-50. | ||||
| Ref 535438 | Chronic inhibition of circulating dipeptidyl peptidase IV by FE 999011 delays the occurrence of diabetes in male zucker diabetic fatty rats. Diabetes. 2002 May;51(5):1461-9. | ||||
| Ref 535810 | Dipeptidyl peptidase IV (CD 26) gene expression in enterocyte-like colon cancer cell lines HT-29 and Caco-2. Cloning of the complete human coding sequence and changes of dipeptidyl peptidase IV mRNA levels during cell differentiation. J Biol Chem. 1992 Mar 5;267(7):4824-33. | ||||
| Ref 535813 | Cloning and functional expression of the T cell activation antigen CD26. J Immunol. 1992 Jul 15;149(2):481-6. | ||||
| Ref 537022 | Emerging drug candidates of dipeptidyl peptidase IV (DPP IV) inhibitor class for the treatment of Type 2 Diabetes. Curr Drug Targets. 2009 Jan;10(1):71-87. | ||||
| Ref 537230 | Combining a dipeptidyl peptidase-4 inhibitor, alogliptin, with pioglitazone improves glycaemic control, lipid profiles and beta-cell function in db/db mice. Br J Pharmacol. 2009 Jun;157(3):415-26. Epub 2009 Apr 3. | ||||
| Ref 537506 | Novel therapeutics for type 2 diabetes: Incretin hormone mimetics (glucagon-like peptide-1 receptor agonists) and dipeptidyl peptidase-4 inhibitors. Pharmacol Ther. 2009 Jun 21. | ||||
| Ref 543447 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1612). | ||||
| Ref 544150 | Incorporating Incretin-Based Therapies Into Clinical Practice: Differences Between Glucagon-Like Peptide 1 Receptor Agonists and Dipeptidyl Peptidase 4 Inhibitors. Mayo Clin Proc. 2010 December; 85(12 Suppl): S27-S37. | ||||
| Ref 544485 | Navigating the chemical space of dipeptidyl peptidase-4 inhibitors. Drug Des Devel Ther. 2015; 9: 4515-4549. | ||||
| Ref 549776 | Dipeptidyl Peptidase-4 Inhibitors Clinical data and clinical implications. before print March 2, 2007. | ||||
| Ref 550054 | Novel Pharmacological Approaches to the Treatment of Type 2 Diabetes. Pharmacological Reviews April 2012 vol. 64 no. 2 188-237. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

