Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T38301
|
||||
| Former ID |
TTDS00421
|
||||
| Target Name |
Ribonucleoside-diphosphatereductase subunit M2
|
||||
| Gene Name |
RRM2
|
||||
| Synonyms |
RR2; Ribonucleotide reductase small chain; Ribonucleotide reductase small subunit; RRM2
|
||||
| Target Type |
Successful
|
||||
| Disease | Chronic myelogenous leukaemia [ICD9: 205.1; ICD10: C92.1] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Gastric cancer [ICD9: 151; ICD10: C16] | |||||
| Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
| Metastatic pancreatic [ICD10: C25.9] | |||||
| Nerve injury [ICD10: T14.4] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling.
|
||||
| BioChemical Class |
Oxidoreductases acting on CH or CH(2) groups
|
||||
| Target Validation |
T38301
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.17.4.1
|
||||
| Sequence |
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKT
KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLK PEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI DTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSF ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTN FFEKRVGEYQRMGVMSSPTENSFTLDADF |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Gemcitabine | Drug Info | Approved | Cancer | [468022], [536739] |
| Hydroxyurea | Drug Info | Approved | Chronic myelogenous leukaemia | [537415], [541904] | |
| CO-101 | Drug Info | Phase 2 | Metastatic pancreatic | [523237] | |
| Triapine | Drug Info | Phase 2 | Nerve injury | [530131] | |
| CALAA-01 | Drug Info | Phase 1 | Solid tumours | [522336] | |
| Gemcitabine prodrug | Drug Info | Phase 1 | Cancer | [523989], [531557] | |
| LY-2334737 | Drug Info | Phase 1 | Solid tumours | [523989] | |
| NKP-46 | Drug Info | Preclinical | Solid tumours | [546342] | |
| Gallium maltolate | Drug Info | Discontinued in Phase 2 | Human immunodeficiency virus infection | [547230] | |
| MDL 101,731 | Drug Info | Discontinued in Phase 2 | Gastric cancer | [545234] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Pyrimidine deoxyribonucleotides biosynthesis from CTP | ||||
| Pyrimidine deoxyribonucleotides de novo biosynthesis | |||||
| Guanosine nucleotides de novo biosynthesis | |||||
| Superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis | |||||
| Superpathway of purine nucleotide salvage | |||||
| Purine nucleotides de novo biosynthesis | |||||
| Adenosine deoxyribonucleotides de novo biosynthesis | |||||
| Guanosine deoxyribonucleotides de novo biosynthesis | |||||
| KEGG Pathway | Purine metabolism | ||||
| Pyrimidine metabolism | |||||
| Glutathione metabolism | |||||
| Metabolic pathways | |||||
| p53 signaling pathway | |||||
| NetPath Pathway | EGFR1 Signaling Pathway | ||||
| PANTHER Pathway | p53 pathway | ||||
| De novo purine biosynthesis | |||||
| De novo pyrimidine deoxyribonucleotide biosynthesis | |||||
| Pathway Interaction Database | E2F transcription factor network | ||||
| PathWhiz Pathway | Purine Metabolism | ||||
| Pyrimidine Metabolism | |||||
| Reactome | E2F mediated regulation of DNA replication | ||||
| G1/S-Specific Transcription | |||||
| WikiPathways | Nucleotide Metabolism | ||||
| Retinoblastoma (RB) in Cancer | |||||
| Metabolism of nucleotides | |||||
| Fluoropyrimidine Activity | |||||
| References | |||||
| Ref 468022 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4793). | ||||
| Ref 522336 | ClinicalTrials.gov (NCT00689065) Safety Study of CALAA-01 to Treat Solid Tumor Cancers. U.S. National Institutes of Health. | ||||
| Ref 523237 | ClinicalTrials.gov (NCT01233375) Study to Evaluate Efficacy of CO-1.01 as Second Line Therapy for Gemcitabine-Refractory Stage IV Pancreatic Adenocarcinoma. U.S. National Institutes of Health. | ||||
| Ref 523989 | ClinicalTrials.gov (NCT01648764) A Study of LY2334737 in Participants With Cancer That is Advanced and/or Has Spread. U.S. National Institutes of Health. | ||||
| Ref 530131 | PAN-811 inhibits oxidative stress-induced cell death of human Alzheimer's disease-derived and age-matched olfactory neuroepithelial cells via suppression of intracellular reactive oxygen species. J Alzheimers Dis. 2009;17(3):611-9. | ||||
| Ref 531557 | Phase I study of Oral gemcitabine prodrug (LY2334737) alone and in combination with erlotinib in patients with advanced solid tumors. Clin Cancer Res. 2011 Sep 15;17(18):6071-82. | ||||
| Ref 536739 | Emerging drugs in cutaneous T cell lymphoma. Expert Opin Emerg Drugs. 2008 Jun;13(2):345-61. | ||||
| Ref 537415 | Guidelines of care for the management of psoriasis and psoriatic arthritis Section . Guidelines of care for the management and treatment of psoriasis with traditional systemic agents. J Am Acad Dermatol. 2009 Jun 1. | ||||
| Ref 541904 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6822). | ||||
| Ref 545234 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002544) | ||||
| Ref 528297 | Gallium maltolate is a promising chemotherapeutic agent for the treatment of hepatocellular carcinoma. Anticancer Res. 2006 May-Jun;26(3A):1739-43. | ||||
| Ref 530131 | PAN-811 inhibits oxidative stress-induced cell death of human Alzheimer's disease-derived and age-matched olfactory neuroepithelial cells via suppression of intracellular reactive oxygen species. J Alzheimers Dis. 2009;17(3):611-9. | ||||
| Ref 532325 | Phase I study of oral gemcitabine prodrug (LY2334737) in Japanese patients with advanced solid tumors. Cancer Chemother Pharmacol. 2013 Jun;71(6):1645-55. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

