Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T40016
|
||||
| Former ID |
TTDS00283
|
||||
| Target Name |
Glucocorticoid receptor
|
||||
| Gene Name |
NR3C1
|
||||
| Synonyms |
Alpha-A; GR; NR3C1
|
||||
| Target Type |
Successful
|
||||
| Disease | Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4] | ||||
| Asthma [ICD10: J45] | |||||
| Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
| Atopic dermatitis [ICD9: 691.8, 692.9; ICD10: L00-L99] | |||||
| Asthma; Non-infectious rhinitis [ICD9: 472.0, 477, 493; ICD10: J00, J30, J31.0, J45] | |||||
| Asthma; Chronic obstructive pulmonary disease [ICD9: 490-492, 493, 494-496; ICD10: J40-J44, J47, J45] | |||||
| Ataxia telangiectasia [ICD10: G11.3] | |||||
| Chronic obstructive pulmonary disease; Asthma [ICD9: 490-492, 493, 494-496; ICD10: J40-J44, J47, J45] | |||||
| Corticosteroid-responsive inflammation [ICD code not available] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Cushing's disease [ICD9: 255; ICD10: E24.0] | |||||
| Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
| Dermatitis [ICD9: 692.9; ICD10: L20-L30] | |||||
| Dermatological disease [ICD10: L00-L99] | |||||
| Duchenne muscular dystrophy [ICD10: G71.0] | |||||
| Depression [ICD9: 311; ICD10: F30-F39] | |||||
| Eczema [ICD10: L20-L30] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Inflammation [ICD10: E08-E13, E10.2, E11, E11.2, E13.2, I73.9, I80-I82, N00-N29, G89] | |||||
| Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
| Otitis externa [ICD10: H60] | |||||
| Ocular disease [ICD10: H00-H59] | |||||
| Rhinitis [ICD9: 472.0, 477; ICD10: J00, J30, J31.0] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Severe mood disorders [ICD9: 296; ICD10: F30-F39] | |||||
| Skin allergies [ICD9: 995.3; ICD10: T78.4] | |||||
| Spinal cord injury [ICD10: S14, S24, S34] | |||||
| Xerophthalmia [ICD10: E50.6-E50.7] | |||||
| Function |
Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth. Involved in chromatin remodeling. May play a negative role in adipogenesis through the regulation of lipolytic and antilipogenic genes expression.
|
||||
| BioChemical Class |
Zinc-finger
|
||||
| Target Validation |
T40016
|
||||
| UniProt ID | |||||
| Sequence |
MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK |
||||
| Structure |
1M2Z; 1NHZ; 1P93; 3BQD; 3CLD; 3E7C; 3H52; 3K22; 3K23; 4CSJ; 4HN5;4HN6; 4LSJ; 4MDD; 4P6W; 4P6X; 1M2Z; 1NHZ; 1P93; 3BQD; 3CLD; 3E7C; 3H52; 3K22; 3K23; 4CSJ; 4HN5; 4HN6; 4LSJ; 4MDD; 4P6W; 4P6X
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Betamethasone | Drug Info | Approved | Inflammatory disease | [538521], [542068] |
| Betamethasone Benzoate | Drug Info | Approved | Inflammation | [551871] | |
| Betamethasone Valerate | Drug Info | Approved | Dermatological disease | [551871] | |
| Budesonide | Drug Info | Approved | Asthma; Non-infectious rhinitis | [536361], [542457] | |
| Deflazacort | Drug Info | Approved | Duchenne muscular dystrophy | [524244], [551871], [889446] | |
| Dexamethasone | Drug Info | Approved | Rheumatoid arthritis | [536737], [540387] | |
| Dexamethasone sodium phosphate | Drug Info | Approved | Ataxia telangiectasia | [549193] | |
| Flunisolide | Drug Info | Approved | Allergic rhinitis | [538285], [542082] | |
| Fluocinolone Acetonide | Drug Info | Approved | Inflammatory disease | [538524], [542083] | |
| Fluorometholone | Drug Info | Approved | Corticosteroid-responsive inflammation | [551871] | |
| Fluticasone | Drug Info | Approved | Allergic rhinitis | [551871] | |
| GW685698X | Drug Info | Approved | Chronic obstructive pulmonary disease; Asthma | [522134], [551873] | |
| Hydrocortamate | Drug Info | Approved | Inflammatory disease | [538430] | |
| Hydrocortisone | Drug Info | Approved | Inflammatory disease | [536361], [539893] | |
| Meprednisone | Drug Info | Approved | Chronic obstructive pulmonary disease | [551871] | |
| Methylprednisolone Acetate | Drug Info | Approved | Cancer | [551871] | |
| Mifepristone | Drug Info | Approved | Cushing's disease | [525064], [539846], [551871] | |
| Mometasone | Drug Info | Approved | Skin allergies | [536361] | |
| Prednisolone | Drug Info | Approved | Cancer | [551871] | |
| Prednisone | Drug Info | Approved | Inflammatory disease | [536737], [542102] | |
| Triamcinolone | Drug Info | Approved | Allergic rhinitis | [551871] | |
| FST-201 | Drug Info | Phase 3 | Otitis externa | [522739] | |
| Mapracorat | Drug Info | Phase 3 | Ocular disease | [523362], [543227] | |
| Prednisolone | Drug Info | Phase 3 | Multiple scierosis | [525302], [539891] | |
| 870086 (topical, atopic dermatitis), GlaxoSmithKline | Drug Info | Phase 2 | Atopic dermatitis | [522149], [523364] | |
| DE-110 | Drug Info | Phase 2 | Xerophthalmia | [523248] | |
| ETIPREDNOL DICLOACETATE | Drug Info | Phase 2 | Rhinitis | [521510] | |
| GW-870086-X | Drug Info | Phase 2 | Asthma | [522149], [523364] | |
| LAS-41002 | Drug Info | Phase 2 | Eczema | [523032] | |
| ORG 34517/34850 | Drug Info | Phase 2 | Severe mood disorders | [536580] | |
| ORG-34517 | Drug Info | Phase 2 | Depression | [521717] | |
| TPI-1020 | Drug Info | Phase 2 | Chronic obstructive pulmonary disease | [522042] | |
| NCX-1015 | Drug Info | Phase 1 | Rheumatoid arthritis | [526716] | |
| AZD-5423 | Drug Info | Discontinued in Phase 2 | Asthma; Chronic obstructive pulmonary disease | [549011] | |
| GSK870086 | Drug Info | Discontinued in Phase 2 | Asthma | [548295] | |
| NM-135 | Drug Info | Discontinued in Phase 2 | Dermatitis | [546950] | |
| WC-3027 | Drug Info | Discontinued in Phase 2 | Chronic obstructive pulmonary disease | [548039] | |
| PF-251802 | Drug Info | Discontinued in Phase 1 | Rheumatoid arthritis | [548806] | |
| Org-34116 | Drug Info | Terminated | Anxiety disorder | [546942] | |
| Methylprednisolone Acetate | Drug Info | Investigative | Spinal cord injury | [542093] | |
| Agonist | 870086 (topical, atopic dermatitis), GlaxoSmithKline | Drug Info | [532254] | ||
| AZD-5423 | Drug Info | [533056] | |||
| Betamethasone | Drug Info | [536246] | |||
| DE-110 | Drug Info | [549039] | |||
| Dexamethasone | Drug Info | [537240], [537639] | |||
| Dexamethasone sodium phosphate | Drug Info | [532454] | |||
| Flunisolide | Drug Info | [537122] | |||
| FST-201 | Drug Info | [530380] | |||
| GW-870086-X | Drug Info | [532254] | |||
| GW685698X | Drug Info | [550963] | |||
| Mapracorat | Drug Info | [530111] | |||
| Mometasone | Drug Info | [535655] | |||
| PF-251802 | Drug Info | [550632] | |||
| Prednisone | Drug Info | [537958] | |||
| WC-3027 | Drug Info | [548040] | |||
| Inhibitor | B-Octylglucoside | Drug Info | [551393] | ||
| Hexane-1,6-Diol | Drug Info | [551393] | |||
| ZK-230211 | Drug Info | [525950] | |||
| Modulator | Betamethasone Benzoate | Drug Info | [556264] | ||
| Betamethasone Valerate | Drug Info | [556264] | |||
| Deflazacort | Drug Info | [556264] | |||
| ETIPREDNOL DICLOACETATE | Drug Info | ||||
| Fluocinolone Acetonide | Drug Info | [556264] | |||
| GSK870086 | Drug Info | [550860] | |||
| Hydrocortamate | Drug Info | [556264] | |||
| Hydrocortisone | Drug Info | [556264] | |||
| LAS-41002 | Drug Info | [544252] | |||
| Meprednisone | Drug Info | [556264] | |||
| Methylprednisolone Acetate | Drug Info | [556264] | |||
| Mifepristone | Drug Info | [528847] | |||
| NCX-1015 | Drug Info | [526716] | |||
| NM-135 | Drug Info | [534820] | |||
| Prednisolone | Drug Info | [525912] | |||
| Triamcinolone | Drug Info | [556264] | |||
| Antagonist | Budesonide | Drug Info | [535660], [537013] | ||
| Fluticasone | Drug Info | [535660], [536736] | |||
| ORG 34517/34850 | Drug Info | [536580] | |||
| Org-34116 | Drug Info | [526476] | |||
| ORG-34517 | Drug Info | [529897] | |||
| TPI-1020 | Drug Info | [531896] | |||
| Binder | Fluorometholone | Drug Info | [535767] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| Pathway Interaction Database | Regulation of nuclear SMAD2/3 signaling | ||||
| Signaling events mediated by HDAC Class II | |||||
| FOXA2 and FOXA3 transcription factor networks | |||||
| Glucocorticoid receptor regulatory network | |||||
| Regulation of Androgen receptor activity | |||||
| AP-1 transcription factor network | |||||
| Reactome | CLOCK,NPAS2 activates circadian gene expression | ||||
| WikiPathways | Serotonin Receptor 4/6/7 and NR3C Signaling | ||||
| SIDS Susceptibility Pathways | |||||
| Nuclear Receptors Meta-Pathway | |||||
| Endoderm Differentiation | |||||
| Cytodifferentiation (Part 3 of 3) | |||||
| Adipogenesis | |||||
| Circadian Clock | |||||
| Nuclear Receptors | |||||
| References | |||||
| Ref 521510 | ClinicalTrials.gov (NCT00035503) Multicenter Trial For Patients With Acute Crohn's Disease. U.S. National Institutes of Health. | ||||
| Ref 521717 | ClinicalTrials.gov (NCT00212797) A Study to Determine the Efficacy and Safety of 2 Doses of Org 34517 as Adjunctive Therapy in Subjects With Psychotic Major Depression (28130)(P05845). U.S. National Institutes of Health. | ||||
| Ref 522042 | ClinicalTrials.gov (NCT00483743) Safety, Tolerability and PD Activity of Inhaled TPI 1020 Versus Inhaled Budesonide in COPD Patients. U.S. National Institutes of Health. | ||||
| Ref 522134 | ClinicalTrials.gov (NCT00539006) Comparator Study Evaluating Patient Preference Of FFNS vs. FPNS. U.S. National Institutes of Health. | ||||
| Ref 522149 | ClinicalTrials.gov (NCT00549497) A Randomized Study Evaluating Steroid Hormone Levels, Safety And Tolerability Of GW870086X In Healthy Volunteers. U.S. National Institutes of Health. | ||||
| Ref 522739 | ClinicalTrials.gov (NCT00945646) FST-201 In The Treatment of Acute Fungal Otitis Externa. U.S. National Institutes of Health. | ||||
| Ref 523032 | ClinicalTrials.gov (NCT01119313) Study to Investigate Skin Conditions and Patient Assessment of LAS 41002 in the Treatment of Atopic Eczema. U.S. National Institutes of Health. | ||||
| Ref 523248 | ClinicalTrials.gov (NCT01239069) Safety and Efficacy Study of DE-110 Ophthalmic Suspension for the Treatment of Dry Eye Disease. U.S. National Institutes of Health. | ||||
| Ref 523362 | ClinicalTrials.gov (NCT01298752) Mapracorat Ophthalmic Suspension, 3% for the Treatment of Ocular Inflammation Following Cataract Surgery. U.S. National Institutes of Health. | ||||
| Ref 523364 | ClinicalTrials.gov (NCT01299610) A Study to Test the Effect of 2 Different Doses of Topical GW870086X on Atopic Dermatitis Also Including a Postive Control and a Placebo. U.S. National Institutes of Health. | ||||
| Ref 524244 | ClinicalTrials.gov (NCT01817322) Kidney Graft Function Under the Immunosuppression Strategies. U.S. National Institutes of Health. | ||||
| Ref 525064 | ClinicalTrials.gov (NCT02342002) Mifepristone and Misoprostol Versus Misoprostol Alone for Missed Abortion: A Randomized-controlled Trial. U.S. National Institutes of Health. | ||||
| Ref 525302 | ClinicalTrials.gov (NCT02534896) To Evaluate The Efficacy And Safety Of Intravenous Pegylated Liposomal Prednisolone Sodium Phosphate (Nanocort) Compared With Intramuscular Injection Of Methylprednisolone Acetate In Subjects With Active Rheumatoid Arthritis. | ||||
| Ref 526716 | Glucocorticoid receptor nitration leads to enhanced anti-inflammatory effects of novel steroid ligands. J Immunol. 2003 Sep 15;171(6):3245-52. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
| Ref 536737 | Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. | ||||
| Ref 538285 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074805. | ||||
| Ref 538430 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010554. | ||||
| Ref 538521 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 019137. | ||||
| Ref 538524 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 019452. | ||||
| Ref 539846 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2805). | ||||
| Ref 539891 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2866). | ||||
| Ref 539893 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2868). | ||||
| Ref 540387 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3447). | ||||
| Ref 542068 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7061). | ||||
| Ref 542082 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7076). | ||||
| Ref 542083 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7077). | ||||
| Ref 542093 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7088). | ||||
| Ref 542102 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7096). | ||||
| Ref 542457 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7434). | ||||
| Ref 543227 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8643). | ||||
| Ref 546942 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011369) | ||||
| Ref 546950 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011462) | ||||
| Ref 548039 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021444) | ||||
| Ref 548295 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024246) | ||||
| Ref 548806 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029003) | ||||
| Ref 549011 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031497) | ||||
| Ref 549193 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033526) | ||||
| Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| Ref 525912 | Aldosterone (mineralocorticoid) equivalent to prednisolone (glucocorticoid) in reversing hearing loss in MRL/MpJ-Fas1pr autoimmune mice. Laryngoscope. 2000 Nov;110(11):1902-6. | ||||
| Ref 525950 | J Med Chem. 2000 Dec 28;43(26):5010-6.Synthesis and biological activity of a novel, highly potent progesterone receptor antagonist. | ||||
| Ref 526476 | Blockade of glucocorticoid receptors with ORG 34116 does not normalize stress-induced symptoms in male tree shrews. Eur J Pharmacol. 2002 Dec 20;457(2-3):207-16. | ||||
| Ref 526716 | Glucocorticoid receptor nitration leads to enhanced anti-inflammatory effects of novel steroid ligands. J Immunol. 2003 Sep 15;171(6):3245-52. | ||||
| Ref 528847 | The glucocorticoid agonist activities of mifepristone (RU486) and progesterone are dependent on glucocorticoid receptor levels but not on EC50 values. Steroids. 2007 Jun;72(6-7):600-8. Epub 2007 Apr7. | ||||
| Ref 529897 | Differential effects of the new glucocorticoid receptor antagonist ORG 34517 and RU486 (mifepristone) on glucocorticoid receptor nuclear translocation in the AtT20 cell line. Ann N Y Acad Sci. 2008 Dec;1148:536-41. | ||||
| Ref 530111 | Characterization of ZK 245186, a novel, selective glucocorticoid receptor agonist for the topical treatment of inflammatory skin diseases. Br J Pharmacol. 2009 Oct;158(4):1088-103. | ||||
| Ref 530380 | A combination povidone-iodine 0.4%/dexamethasone 0.1% ophthalmic suspension in the treatment of adenoviral conjunctivitis. Adv Ther. 2009 Aug;26(8):776-83. | ||||
| Ref 531896 | Bronchoprotection in conscious guinea pigs by budesonide and the NO-donating analogue, TPI 1020, alone and combined with tiotropium or formoterol. Br J Pharmacol. 2012 Oct;167(3):515-26. | ||||
| Ref 532254 | Unique response profile of trabecular meshwork cells to the novel selective glucocorticoid receptor agonist, GW870086X. Invest Ophthalmol Vis Sci. 2013 Mar 1;54(3):2100-7. | ||||
| Ref 532454 | Dexamethasone rapidly increases GABA release in the dorsal motor nucleus of the vagus via retrograde messenger-mediated enhancement of TRPV1 activity. PLoS One. 2013 Jul 30;8(7):e70505. | ||||
| Ref 533056 | A nonsteroidal glucocorticoid receptor agonist inhibits allergen-induced late asthmatic responses. Am J Respir Crit Care Med. 2015 Jan 15;191(2):161-7. | ||||
| Ref 534820 | Local anti-inflammatory activity and systemic side effects of NM-135, a new prodrug glucocorticoid, in an experimental inflammatory rat model. Jpn J Pharmacol. 1998 Dec;78(4):505-9. | ||||
| Ref 535655 | Mometasone furoate is a less specific glucocorticoid than fluticasone propionate. Eur Respir J. 2002 Dec;20(6):1386-92. | ||||
| Ref 535660 | Knockouts model the 100 best-selling drugs--will they model the next 100? Nat Rev Drug Discov. 2003 Jan;2(1):38-51. | ||||
| Ref 535767 | Loteprednol etabonate: a soft steroid for the treatment of allergic diseases of the airways. Drugs Today (Barc). 2000 May;36(5):313-20. | ||||
| Ref 536246 | The cannabinoid CB2 receptor inverse agonist JTE-907 suppresses spontaneous itch-associated responses of NC mice, a model of atopic dermatitis. Eur J Pharmacol. 2006 Aug 7;542(1-3):179-83. Epub 2006Jun 2. | ||||
| Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
| Ref 536736 | Fluticasone furoate nasal spray in allergic rhinitis. Drugs Today (Barc). 2008 Apr;44(4):251-60. | ||||
| Ref 537013 | PXR-mediated induction of human CYP3A4 and mouse Cyp3a11 by the glucocorticoid budesonide. Eur J Pharm Sci. 2009 Mar 2;36(4-5):565-71. Epub 2008 Dec 24. | ||||
| Ref 537122 | The glucocorticoid receptor heterocomplex gene STIP1 is associated with improved lung function in asthmatic subjects treated with inhaled corticosteroids. J Allergy Clin Immunol. 2009 Jun;123(6):1376-83.e7. Epub 2009 Feb 28. | ||||
| Ref 537240 | Interaction between the glucocorticoid and erythropoietin receptors in human erythroid cells. Exp Hematol. 2009 May;37(5):559-72. | ||||
| Ref 537639 | Functional mineralocorticoid receptor (MR) gene variation influences the cortisol awakening response after dexamethasone. Psychoneuroendocrinology. 2009 Aug 6. | ||||
| Ref 537958 | Cytochromes P450 (CYP) in the Poeciliopsis lucida hepatocellular carcinoma cell line (PLHC-1): dose- and time-dependent glucocorticoid potentiation of CYP1A induction without induction of CYP3A. ArchBiochem Biophys. 1996 May 1;329(1):113-22. | ||||
| Ref 544252 | Barrier-Restoring Therapies in Atopic Dermatitis: Current Approaches and Future Perspectives. Dermatol Res Pract. 2012; 2012: 923134. | ||||
| Ref 548040 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021444) | ||||
| Ref 549039 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031667) | ||||
| Ref 550632 | Glucocorticoids Pharmacology: Past, Present and Future. Current Pharmaceutical Design. VOLUME 16, ISSUE 32, Page(3540-3553), DOI: 10.2174/138161210793797915. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

