Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T40492
|
||||
| Former ID |
TTDR00103
|
||||
| Target Name |
Nonstructural protein NS3
|
||||
| Synonyms |
HCV NS3 RNA helicase; Hepacivirin; Hepatitis C Virus RNA Helicase; Hepatitis C virus NS3 serine proteinase; NS3; NS3 protease; NS3 protein; Nonstructural protein 3; ORF-C; P70; Protease/helicase NS3; RNA helicase; Ribonucleic acid (RNA) helicase; SM protein
|
||||
| Target Type |
Successful
|
||||
| Disease | Chronic HCV infection [ICD9: 070.4, 070.5, 070.70; ICD10: B17.1, B18.2] | ||||
| HCV infection [ICD9: 070.4, 070.5, 070.70; ICD10: B17.1, B18.2] | |||||
| Hepatitis virus infection [ICD9: 573.3; ICD10: K75.9] | |||||
| Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
NS5B is an RNA-dependent RNA polymerase that plays an essential role in the virus replication.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T40492
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.21.98
|
||||
| Sequence |
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTAAQTFLATCINGVCWTVYHGAG
TRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRG DSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVENLETTMR SPVFTDNSSPPVVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGA YMSKAHGIDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSI LGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSTTGEIPFYGKAIPLEVIK GGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVATDALMTGYTG DFDSVIDCNTCVTQTVDFSLDPTFTIETITLPQDAVSRTQRRGRTGRGKPGIYRFVAPGE RPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLT HIDAHFLSQTKQSGENLPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLY RLGAVQNEITLTHPVTKYIMTCMSADLEVVT |
||||
| Structure |
1RTL; 2A4G; 2GVF; 3EYD; 3HKW; 3KN2; 3QGH; 3QGI; 3RC4; 3RC5
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ombitasvir/paritaprevir/ritonavir | Drug Info | Approved | Unspecified | [551871] |
| BILN-2061 | Drug Info | Phase 2 | Hepatitis virus infection | [524893] | |
| GS-9451 | Drug Info | Phase 2 | Chronic HCV infection | [523476] | |
| GS-9857 | Drug Info | Phase 2 | HCV infection | [524851] | |
| ACH-2684 | Drug Info | Phase 1 | HCV infection | [549256] | |
| VBY-376 | Drug Info | Phase 1 | HCV infection | [522157] | |
| BMS-605339 | Drug Info | Terminated | HCV infection | [548960] | |
| Inhibitor | 2,4,6-Trihydroxy-3-nitro-N-tridecyl-benzamide | Drug Info | [527362] | ||
| Ac-Glu-Cha-Cys | Drug Info | [525978] | |||
| AcAsp-D-Gla-Leu-Ile-Cha-Cys | Drug Info | [527362] | |||
| AcAsp-D-Glu-Leu-Glu-Cha-Cys | Drug Info | [525978] | |||
| AcAsp-Gla-Leu-Ile-Cha-Cys | Drug Info | [525978] | |||
| AcAsp-Glu-Cha-Val-Prb-Cpg | Drug Info | [527362] | |||
| AcAsp-Glu-Cha-Val-Prb-Cys | Drug Info | [527362] | |||
| AcAsp-Glu-Dif-Glu-Cha-Cys | Drug Info | [527362] | |||
| AcAsp-Glu-Dif-Glu-Cha-Fab | Drug Info | [527362] | |||
| AcAsp-Glu-Dif-Ile-Cha-Cys | Drug Info | [525978] | |||
| AcAsp-Glu-Dif-Ile-Cha-Cys-Iqc-Nle-Thr-TyrNH2 | Drug Info | [527362] | |||
| AcAsp-Glu-Dif-Ile-Cha-Cys-Pro-Cha-Asp-ValNH2 | Drug Info | [527362] | |||
| AcAsp-Glu-Dif-Ile-Cha-Cys-Pro-Nle-Asp-ValNH2 | Drug Info | [527362] | |||
| AcAsp-Glu-Dif-Lys-Cha-Cys | Drug Info | [525978] | |||
| AcAsp-Glu-Leu-Glu-Cha-Cys | Drug Info | [525978] | |||
| AcAsp-Glu-Met-Glu-Cha-Cys | Drug Info | [525978] | |||
| AcAsp-Glu-Met-Glu-Glu-Cys | Drug Info | [527362] | |||
| AcAsp-Glu-Met-Glu-Nal-Cyse | Drug Info | [525978] | |||
| AcDif-Glu-Cha-Cys | Drug Info | [525978] | |||
| AcDif-Ile-Cha-Cys | Drug Info | [525978] | |||
| AcGlu-Asp-Val-Val-Leu-Cys-Iqc-Nle-Thr-TyrNH2 | Drug Info | [527362] | |||
| AcGlu-Dif-Glu-Cha-Cys | Drug Info | [525978] | |||
| AcGlu-Dif-Ile-Cha-Cys | Drug Info | [525978] | |||
| Asp-D-Glu-Leu-Glu-Cha-Cys | Drug Info | [525978] | |||
| Azapeptide | Drug Info | [526299] | |||
| Azapeptide derivative | Drug Info | [527130] | |||
| BILN-2061 | Drug Info | [536050] | |||
| BMS-605339 | Drug Info | [532678] | |||
| Boc-Ile-Leu-L-(difluoro)aminobutyric aid | Drug Info | [527362] | |||
| Cbz-Ile-Leu-L-(difluoro)aminobutyric acid | Drug Info | [527362] | |||
| GNF-PF-3464 | Drug Info | [531262] | |||
| GS-9857 | Drug Info | [550822] | |||
| PATULIN | Drug Info | [527362] | |||
| Peptide Boronic Acid analogue | Drug Info | [526438] | |||
| Ribavirin-TP | Drug Info | [535038] | |||
| SCH-68631 | Drug Info | [527362] | |||
| VBY-376 | Drug Info | [544195] | |||
| Modulator | ACH-2684 | Drug Info | [1572591] | ||
| GS-9451 | Drug Info | [544260] | |||
| Ombitasvir/paritaprevir/ritonavir | Drug Info | ||||
| References | |||||
| Ref 522157 | ClinicalTrials.gov (NCT00557583) Evaluation of Safety and Pharmacokinetics of Single Doses of VBY-376 in Healthy Adults. U.S. National Institutes of Health. | ||||
| Ref 523476 | ClinicalTrials.gov (NCT01353248) GS 5885 Administered Concomitantly With GS-9451, Tegobuvir and Ribavirin (RBV) in Chronic Genotype 1 Hepatitis C Virus (HCV) Infection. U.S. National Institutes of Health. | ||||
| Ref 524851 | ClinicalTrials.gov (NCT02202980) Efficacy and Safety of Oral Regimens for the Treatment of Chronic HCV Infection. U.S. National Institutes of Health. | ||||
| Ref 524893 | ClinicalTrials.gov (NCT02226939) Antiviral Efficacy, Pharmacokinetics and Safety of BILN 2061 ZW in Patients With Cirrhosis and Chronic Hepatitis C. U.S. National Institutes of Health. | ||||
| Ref 548960 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030836) | ||||
| Ref 525978 | Bioorg Med Chem Lett. 2001 Jan 22;11(2):203-6.Inhibition of hepatitis C virus NS3 protease activity by product-based peptides is dependent on helicase domain. | ||||
| Ref 526299 | Bioorg Med Chem Lett. 2002 Apr 8;12(7):1005-8.Azapeptides as inhibitors of the hepatitis C virus NS3 serine protease. | ||||
| Ref 526438 | Bioorg Med Chem Lett. 2002 Nov 4;12(21):3199-202.P1 Phenethyl peptide boronic acid inhibitors of HCV NS3 protease. | ||||
| Ref 527130 | J Med Chem. 2004 Jul 15;47(15):3788-99.Novel azapeptide inhibitors of hepatitis C virus serine protease. | ||||
| Ref 527362 | J Med Chem. 2005 Jan 13;48(1):1-20.Control of hepatitis C: a medicinal chemistry perspective. | ||||
| Ref 531262 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). | ||||
| Ref 532678 | Discovery and early clinical evaluation of BMS-605339, a potent and orally efficacious tripeptidic acylsulfonamide NS3 protease inhibitor for the treatment of hepatitis C virus infection. J Med Chem.2014 Mar 13;57(5):1708-29. | ||||
| Ref 535038 | ATP-binding domain of NTPase/helicase as a target for hepatitis C antiviral therapy. Acta Biochim Pol. 2000;47(1):173-80. | ||||
| Ref 536050 | Antiviral efficacy of NS3-serine protease inhibitor BILN-2061 in patients with chronic genotype 2 and 3 hepatitis C. Hepatology. 2005 Apr;41(4):832-5. | ||||
| Ref 544195 | Hepatitis C Virus NS3/4A Protease Inhibitors: A Light at the End of the Tunnel. Viruses. 2010 August; 2(8): 1752-1765. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

