Target General Infomation
Target ID
T51693
Former ID
TTDR00750
Target Name
Melanoma-associated antigen 3
Gene Name
MAGEA3
Synonyms
Antigen MZ2-D; MAGE-3 antigen; MAGE-A3; MAGE-A3 antigen; Melanoma antigen 3; Melanoma associated antigen-A3; MAGEA3
Target Type
Clinical Trial
Disease Adjuvant non-small-cell lung carcinoma; Melanoma [ICD9:162, 172; ICD10: C33, C34, C43]
Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21]
Melanoma [ICD9: 172; ICD10: C43]
Function
Proposed to enhance ubiquitin ligase activity of RING- type zinc finger-containing E3 ubiquitin-protein ligases. May enhance ubiquitin ligase activity of TRIM28 and stimulate p53/TP53 ubiquitination by TRIM28. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in embryonal development and tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
BioChemical Class
Melanoma associated antigen family
UniProt ID
Sequence
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPD
PPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFL
LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFAT
CLGLSYDGLLGDNQIMPKAGLLIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILG
DPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHMVKISGGPHIS
YPPLHEWVLREGEE
Drugs and Mode of Action
Drug(s) Astuprotimut-R Drug Info Phase 3 Adjuvant non-small-cell lung carcinoma; Melanoma [522494]
IDM-2101 Drug Info Phase 2 Colorectal cancer [529705]
Polynoma-1 Drug Info Phase 2 Melanoma [551529]
Melanoma vaccine Drug Info Discontinued in Phase 2 Melanoma [547218]
Modulator Astuprotimut-R Drug Info [550432]
References
Ref 522494ClinicalTrials.gov (NCT00796445) A Phase III Study to Test the Benefit of a New Kind of Anti-cancer Treatment in Patients With Melanoma, After Surgical Removal of Their Tumor. U.S. National Institutes of Health.
Ref 529705Induction of immune responses and clinical efficacy in a phase II trial of IDM-2101, a 10-epitope cytotoxic T-lymphocyte vaccine, in metastatic non-small-cell lung cancer. J Clin Oncol. 2008 Sep 20;26(27):4418-25.
Ref 547218Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014153)
Ref 551529An immuno-oncology company developing a novel polyvalent antigen therapy for the treatment of melanoma. Polynoma. 2015.
Ref 529705Induction of immune responses and clinical efficacy in a phase II trial of IDM-2101, a 10-epitope cytotoxic T-lymphocyte vaccine, in metastatic non-small-cell lung cancer. J Clin Oncol. 2008 Sep 20;26(27):4418-25.
Ref 531162Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58.
Ref 550432National Cancer Institute Drug Dictionary (drug id 600553).
Ref 551529An immuno-oncology company developing a novel polyvalent antigen therapy for the treatment of melanoma. Polynoma. 2015.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.