Target General Infomation
Target ID
T56365
Former ID
TTDC00135
Target Name
B-lymphocyte antigen CD19
Gene Name
CD19
Synonyms
B-lymphocyte surface antigen B4; Differentiation antigen CD19; Leu-12; CD19
Target Type
Clinical Trial
Disease Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0]
Autoimmune diabetes [ICD10: E08-E13]
B-cell lymphoma [ICD9: 202.8; ICD10: C85.1]
Chronic lymphocytic leukaemia [ICD10: C91]
Diffuse large B-cell lymphoma [ICD9: 200; ICD10: C83.3]
Hematologic malignancies [ICD9: 200-209; ICD10: C81-C86]
Lymphoma; Chronic lymphocytic leukemia; Multiple myeloma [ICD9: 202.8, 203.0, 204.1, 208.9; ICD10: C81-C86, C90, C91-C95, C91.1]
Leukemia [ICD9: 208.9; ICD10: C90-C95]
Non-hodgkin's lymphoma [ICD10: C85]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Scleroderma [ICD9: 701.0710.1; ICD10: L94.0-L94.1, M34]
Function
Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
BioChemical Class
Immunoglobulin
Target Validation
T56365
UniProt ID
Sequence
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE
LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL
NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW
VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL
IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG
LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF
YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS
PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP
DPAWGGGGRMGTWSTR
Drugs and Mode of Action
Drug(s) Blinatumomab Drug Info Approved Acute lymphoblastic leukemia [889388], [889412]
CTL019 Drug Info Phase 2 Chronic lymphocytic leukaemia [525190]
JCAR015 Drug Info Phase 2 B-cell lymphoma [525305]
MDX-1342 Drug Info Phase 2 Leukemia [524501]
MOR-208 Drug Info Phase 2 Autoimmune diabetes [524052]
SAR-3419 Drug Info Phase 2 Non-hodgkin's lymphoma [532514]
Xmab 5871 Drug Info Phase 2 Autoimmune diabetes [549317]
JCAR014 Drug Info Phase 1/2 Non-hodgkin's lymphoma [549571]
JCAR017 Drug Info Phase 1/2 Leukemia [549572]
KTE-C19 CAR Drug Info Phase 1/2 Diffuse large B-cell lymphoma [549522]
Xmab5871 Drug Info Phase 1/2 Rheumatoid arthritis [889425]
AFM11 Drug Info Phase 1 Non-hodgkin's lymphoma [524703]
Combotox Drug Info Phase 1 Leukemia [548715]
MEDI-551 Drug Info Phase 1 Lymphoma; Chronic lymphocytic leukemia; Multiple myeloma [542906], [551134]
MEDl-551 Drug Info Phase 1 Scleroderma [531971]
SGN-19A Drug Info Preclinical Hematologic malignancies [551669]
Modulator AFM11 Drug Info [889442]
Anti-CD22/CD19 mab-toxin conjugate Drug Info [525761]
Blinatumomab Drug Info [533123]
Combotox Drug Info
CTL019 Drug Info [551967]
JCAR014 Drug Info [551860]
JCAR015 Drug Info [551860]
JCAR017 Drug Info [551860]
Xmab 5871 Drug Info
Xmab5871 Drug Info [889442]
Inhibitor KTE-C19 CAR Drug Info [549913]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway PI3K-Akt signaling pathway
Hematopoietic cell lineage
B cell receptor signaling pathway
Epstein-Barr virus infection
Primary immunodeficiency
NetPath Pathway IL-7 Signaling Pathway
PANTHER Pathway B cell activation
Pathway Interaction Database BCR signaling pathway
Reactome PIP3 activates AKT signaling
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Constitutive Signaling by Aberrant PI3K in Cancer
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
WikiPathways Human Complement System
Signaling by the B Cell Receptor (BCR)
PIP3 activates AKT signaling
B Cell Receptor Signaling Pathway
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
References
Ref 524052ClinicalTrials.gov (NCT01685008) Study of Fc-Optimized Anti-CD19 Antibody (MOR00208) to Treat Non-Hodgkin?? Lymphoma (NHL). U.S. National Institutes of Health.
Ref 524501ClinicalTrials.gov (NCT01974479) Pilot Study of Redirected Haploidentical Natural Killer Cell Infusions for B-Lineage Acute Lymphoblastic Leukemia. U.S. National Institutes of Health.
Ref 524703ClinicalTrials.gov (NCT02106091) Safety Study to Assess AFM11 in Patients With Relapsed and/or Refractory CD19 Positive B-cell NHL or B-precursor ALL. U.S. National Institutes of Health.
Ref 525190ClinicalTrials.gov (NCT02445248) Study of Efficacy and Safety of CTL019 in Adult DLBCL Patients. U.S. National Institutes of Health.
Ref 525305ClinicalTrials.gov (NCT02535364) Study Evaluating the Efficacy and Safety of JCAR015 in Adult B-cell Acute Lymphoblastic Leukemia (B-ALL).
Ref 531971CD19 as an attractive target for antibody-based therapy. MAbs. 2012 Sep-Oct;4(5):571-7.
Ref 532514A dose-escalation study of SAR3419, an anti-CD19 antibody maytansinoid conjugate, administered by intravenous infusion once weekly in patients with relapsed/refractory B-cell non-Hodgkin lymphoma. Clin Cancer Res. 2014 Jan 1;20(1):213-20.
Ref 542906(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7992).
Ref 548715Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027936)
Ref 549317Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035125)
Ref 549522Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800039436)
Ref 549571Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041075)
Ref 549572Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041076)
Ref 551134Clinical pipeline report, company report or official report of MedImmune (2011).
Ref 5516692011 Pipeline of Seattle Genetics.
Ref 889388ClinicalTrials.gov (NCT02013167) Blinatumomab Versus Standard of Care Chemotherapy in Patients With Relapsed or Refractory Acute Lymphoblastic Leukemia (ALL)
Ref 889412ClinicalTrials.gov (NCT02393859) Phase 3 Trial of Blinatumomab vs Standard Chemotherapy in Pediatric Subjects With HR First Relapse B-precursor ALL
Ref 889425ClinicalTrials.gov (NCT02867098) XmAb5871 Bioavailability Study
Ref 525761Immunotoxins against CD19 and CD22 are effective in killing precursor-B acute lymphoblastic leukemia cells in vitro. Leukemia. 2000 May;14(5):853-8.
Ref 530298A nonfucosylated human antibody to CD19 with potent B-cell depletive activity for therapy of B-cell malignancies. Cancer Immunol Immunother. 2010 Feb;59(2):257-65.
Ref 531971CD19 as an attractive target for antibody-based therapy. MAbs. 2012 Sep-Oct;4(5):571-7.
Ref 532514A dose-escalation study of SAR3419, an anti-CD19 antibody maytansinoid conjugate, administered by intravenous infusion once weekly in patients with relapsed/refractory B-cell non-Hodgkin lymphoma. Clin Cancer Res. 2014 Jan 1;20(1):213-20.
Ref 532984A phase 1 trial of the Fc-engineered CD19 antibody XmAb5574 (MOR00208) demonstrates safety and preliminary efficacy in relapsed CLL. Blood. 2014 Dec 4;124(24):3553-60.
Ref 5331232014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
Ref 549913Clinical pipeline report, company report or official report of Kite Pharma.
Ref 551134Clinical pipeline report, company report or official report of MedImmune (2011).
Ref 5516692011 Pipeline of Seattle Genetics.
Ref 551860Clinical pipeline report, company report or official report of JUNO Therapeutics.
Ref 551967Clinical pipeline report, company report or official report of Novartis.
Ref 889442Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801. doi: 10.1038/nrd4478.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.