Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T60526
|
||||
| Former ID |
TTDR00722
|
||||
| Target Name |
L-selectin
|
||||
| Gene Name |
SELL
|
||||
| Synonyms |
CD62L; Gp90-MEL; LAM-1; LECAM1; Leukocyte adhesion molecule-1; Leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; Lymph node homing receptor; TQ1; SELL
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Asthma [ICD10: J45] | ||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Function |
Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
|
||||
| BioChemical Class |
Selectin/LECAM
|
||||
| Target Validation |
T60526
|
||||
| UniProt ID | |||||
| Sequence |
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDN
YTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPN NKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTC NCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETT CGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKK TICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK GKKSKRSMNDPY |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cell adhesion molecules (CAMs) | ||||
| NetPath Pathway | IL9 Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| Leptin Signaling Pathway | |||||
| Reactome | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
| Cell surface interactions at the vascular wall | |||||
| WikiPathways | Human Complement System | ||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| Cell surface interactions at the vascular wall | |||||
| References | |||||
| Ref 530945 | GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 Sep 9;116(10):1779-86. | ||||
| Ref 531721 | Deal watch: Pfizer deal for selectin inhibitor highlights potential of glycomimetic drugs. Nat Rev Drug Discov. 2011 Dec 1;10(12):890. | ||||
| Ref 543059 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8307). | ||||
| Ref 528676 | J Med Chem. 2007 Mar 22;50(6):1101-15. Epub 2007 Feb 16.Rational design of novel, potent small molecule pan-selectin antagonists. | ||||
| Ref 530945 | GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 Sep 9;116(10):1779-86. | ||||
| Ref 531721 | Deal watch: Pfizer deal for selectin inhibitor highlights potential of glycomimetic drugs. Nat Rev Drug Discov. 2011 Dec 1;10(12):890. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

