Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T61698
|
||||
| Former ID |
TTDR00141
|
||||
| Target Name |
Interleukin-2
|
||||
| Gene Name |
IL2
|
||||
| Synonyms |
Aldesleukin; IL-2; T-cell growth factor; TCGF; IL2
|
||||
| Target Type |
Successful
|
||||
| Disease | Bipolar disorder [ICD9: 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300; ICD10: F31, F40-F42] | ||||
| Chronic lymphocytic leukaemia [ICD10: C91] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | |||||
| Immuno-stimulant [ICD10: C00-C97] | |||||
| Lung cancer [ICD9: 162; ICD10: C33-C34] | |||||
| Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
| Melanoma [ICD9: 172; ICD10: C43] | |||||
| Metastatic renal cell carcer [ICD9: 189; ICD10: C64] | |||||
| Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
| Non-hodgkin's lymphoma [ICD10: C85] | |||||
| Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Renal cancer [ICD9: 140-229, 189; ICD10: C64] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine- activated killer cells, natural killer cells, and glioma cells.
|
||||
| BioChemical Class |
Cytokine: interleukin
|
||||
| UniProt ID | |||||
| Sequence |
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Aldesleukin | Drug Info | Approved | Metastatic renal cell carcer | [536361] |
| Daclizumab | Drug Info | Approved | Multiple scierosis | [889440] | |
| AIR-insulin | Drug Info | Phase 3 | Diabetes | [551855] | |
| TG-4010 | Drug Info | Phase 2/3 | Bipolar disorder | [529572] | |
| Aldesleukin | Drug Info | Phase 2 | Non-hodgkin's lymphoma | [536361] | |
| APN-301 | Drug Info | Phase 2 | Melanoma | [522201] | |
| Human interleukin-2 | Drug Info | Phase 2 | Renal cancer | [551015] | |
| IL-2/CD40L-expressing leukemia vaccine | Drug Info | Phase 2 | Chronic lymphocytic leukaemia | [523912] | |
| L19-IL-2 fusion protein | Drug Info | Phase 2 | Lymphoma | [548544] | |
| Leuvectin | Drug Info | Phase 2 | Melanoma | [521459] | |
| Thymoctonan | Drug Info | Phase 2 | Immuno-stimulant | [521442] | |
| IL-2 XL | Drug Info | Phase 1/2 | Renal cancer | [547897] | |
| IL-2/gene-modified lymphocytes | Drug Info | Phase 1/2 | Ovarian cancer | [521558] | |
| Medusa IL-2 | Drug Info | Phase 1/2 | Cancer | [549990] | |
| VCL-1M01 | Drug Info | Phase 1 | Melanoma | [521725] | |
| VPM-4-001 | Drug Info | Preclinical | Prostate cancer | [548240] | |
| Nuleusin | Drug Info | Discontinued in Phase 3 | Melanoma | [548668] | |
| BIWB-1 | Drug Info | Discontinued in Phase 2 | Melanoma | [545821] | |
| VLTS-587 | Drug Info | Discontinued in Phase 2 | Lung cancer | [546542] | |
| Roquinimex | Drug Info | Discontinued in Phase 1 | Rheumatoid arthritis | [544912] | |
| TG-1024 | Drug Info | Discontinued in Phase 1 | Solid tumours | [546632] | |
| Modulator | AIR-insulin | Drug Info | [528889] | ||
| Aldesleukin | Drug Info | [556264] | |||
| APN-301 | Drug Info | [550261] | |||
| Daclizumab | Drug Info | [889440] | |||
| Human interleukin-2 | Drug Info | [551913] | |||
| IL-2 antibody (anti-tumor), Hybritech | Drug Info | ||||
| IL-2 XL | Drug Info | [549990] | |||
| IL-2/gene-modified lymphocytes | Drug Info | [544272] | |||
| interleukin-2, Roussel Uclaf | Drug Info | ||||
| Leuvectin | Drug Info | [525794] | |||
| Medusa IL-2 | Drug Info | [1572591] | |||
| Roquinimex | Drug Info | [534129] | |||
| TG-1024 | Drug Info | [551644] | |||
| TG-1031 | Drug Info | ||||
| TG-2001 | Drug Info | ||||
| TG-4010 | Drug Info | [529572] | |||
| Thymoctonan | Drug Info | [534072] | |||
| VCL-1M01 | Drug Info | [533711] | |||
| VLTS-587 | Drug Info | [550853] | |||
| Agonist | Nuleusin | Drug Info | [531915] | ||
| Inhibitor | SP2456 | Drug Info | [551393] | ||
| SP4160 | Drug Info | [551393] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| PI3K-Akt signaling pathway | |||||
| Jak-STAT signaling pathway | |||||
| T cell receptor signaling pathway | |||||
| Intestinal immune network for IgA production | |||||
| Type I diabetes mellitus | |||||
| Chagas disease (American trypanosomiasis) | |||||
| Measles | |||||
| HTLV-I infection | |||||
| Autoimmune thyroid disease | |||||
| Inflammatory bowel disease (IBD) | |||||
| Allograft rejection | |||||
| Graft-versus-host disease | |||||
| NetPath Pathway | IL-7 Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
| Interleukin signaling pathway | |||||
| Pathway Interaction Database | IL27-mediated signaling events | ||||
| IL12-mediated signaling events | |||||
| Calcineurin-regulated NFAT-dependent transcription in lymphocytes | |||||
| SHP2 signaling | |||||
| Regulation of Telomerase | |||||
| Glucocorticoid receptor regulatory network | |||||
| IL2-mediated signaling events | |||||
| IL2 signaling events mediated by PI3K | |||||
| AP-1 transcription factor network | |||||
| IL23-mediated signaling events | |||||
| IL2 signaling events mediated by STAT5 | |||||
| Calcium signaling in the CD4+ TCR pathway | |||||
| Downstream signaling in na& | |||||
| #xef | |||||
| ve CD8+ T cells | |||||
| IL12 signaling mediated by STAT4 | |||||
| Reactome | GPVI-mediated activation cascade | ||||
| gamma signalling through PI3Kgamma | |||||
| Interleukin-2 signaling | |||||
| RAF/MAP kinase cascade | |||||
| Interleukin receptor SHC signaling | |||||
| WikiPathways | Cytokines and Inflammatory Response | ||||
| IL-2 Signaling Pathway | |||||
| Inflammatory Response Pathway | |||||
| Aryl Hydrocarbon Receptor Pathway | |||||
| Interleukin-2 signaling | |||||
| T-Cell Receptor and Co-stimulatory Signaling | |||||
| Spinal Cord Injury | |||||
| Corticotropin-releasing hormone | |||||
| Allograft Rejection | |||||
| Arylhydrocarbon receptor (AhR) signaling pathway | |||||
| Interleukin-3, 5 and GM-CSF signaling | |||||
| Folate Metabolism | |||||
| IL-5 Signaling Pathway | |||||
| References | |||||
| Ref 521442 | ClinicalTrials.gov (NCT00002435) A Study of Thymic Humoral Factor (THF Gamma 2) in HIV-Infected Patients. U.S. National Institutes of Health. | ||||
| Ref 521459 | ClinicalTrials.gov (NCT00004050) Leuvectin Followed By Surgery in Treating Patients With Stage II or Stage III Prostate Cancer. U.S. National Institutes of Health. | ||||
| Ref 521558 | ClinicalTrials.gov (NCT00062036) Cyclophosphamide and Fludarabine Followed By Interleukin-2 Gene-Modified Tumor Infiltrating Lymphocytes in Treating Patients With Metastatic Melanoma. U.S. National Institutes of Health. | ||||
| Ref 521725 | ClinicalTrials.gov (NCT00223899) A Trial to Evaluate the Safety of Intratumoral VCL-IM01 Followed by Electroporation in Metastatic Melanoma. U.S. National Institutes of Health. | ||||
| Ref 522201 | ClinicalTrials.gov (NCT00590824) Pilot hu14.18-IL2 in Resectable Recurrent Stage III or Stage IV Melanoma. U.S. National Institutes of Health. | ||||
| Ref 523912 | ClinicalTrials.gov (NCT01604031) Treatment of B-CLL With Autologous IL2 and CD40 Ligand-Expressing Tumor Cells + Lenalidomide. U.S. National Institutes of Health. | ||||
| Ref 529572 | A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 544912 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001478) | ||||
| Ref 545821 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004906) | ||||
| Ref 546542 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008879) | ||||
| Ref 546632 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009282) | ||||
| Ref 547897 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020218) | ||||
| Ref 548240 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023655) | ||||
| Ref 548544 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026492) | ||||
| Ref 548668 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027551) | ||||
| Ref 525794 | Intratumoral interleukin 2 for renal-cell carcinoma by direct gene transfer of a plasmid DNA/DMRIE/DOPE lipid complex. World J Urol. 2000 Apr;18(2):152-6. | ||||
| Ref 527821 | Immunotherapy of high-risk acute leukemia with a recipient (autologous) vaccine expressing transgenic human CD40L and IL-2 after chemotherapy and allogeneic stem cell transplantation. Blood. 2006 Feb15;107(4):1332-41. Epub 2005 Oct 25. | ||||
| Ref 528889 | The AIR inhaled insulin system: system components and pharmacokinetic/glucodynamic data. Diabetes Technol Ther. 2007 Jun;9 Suppl 1:S41-7. | ||||
| Ref 529572 | A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44. | ||||
| Ref 530762 | BioPartnering North America--Programs from Pharma in Europe and the Middle East. IDrugs. 2010 Mar;13(3):162-5. | ||||
| Ref 531915 | Expression, purification and characterization of recombinant human interleukin-2-serum albumin (rhIL-2-HSA) fusion protein in Pichia pastoris. Protein Expr Purif. 2012 Jul;84(1):154-60. | ||||
| Ref 533711 | Interleukin-2 gene therapy in a patient with glioblastoma. Gene Ther. 1995 Mar;2(2):164-7. | ||||
| Ref 534072 | Evaluation of efficacy and safety of thymus humoral factor-gamma 2 in the management of chronic hepatitis B. J Hepatol. 1995 Jul;23(1):21-7. | ||||
| Ref 534129 | The novel immunomodulator, Linomide, stimulates interleukin-2-induced human natural killer (NK) cell and PHA-stimulated T cell proliferation from normal donors. Leuk Res. 1996 Jan;20(1):57-63. | ||||
| Ref 544272 | Genetic modification of human T lymphocytes for the treatment of hematologic malignancies. Haematologica. 2012 November; 97(11): 1622-1631. | ||||
| Ref 549990 | Pharmacokinetics (PK) and immunologic responses in a phase I/II study of a sustained release formulation of IL-2 in renal cell carcinoma (RCC) patients. J Clin Oncol (Meeting Abstracts) June 2006 vol. 24 no. 18_suppl 2558. | ||||
| Ref 551644 | Melanoma and Immunotherapy. Hematology/Oncology Clinics of North America Volume 23, Issue 3, June 2009, Pages 547-564. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

