Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T62460
|
||||
| Former ID |
TTDNS00611
|
||||
| Target Name |
JAK1
|
||||
| Gene Name |
JAK1
|
||||
| Synonyms |
Janus kinase 1; Tyrosine-protein kinase JAK1; JAK1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Essential thrombocythemia [ICD9: 238.71, 289.9; ICD10: D47.3, D75.2, D75.8] | ||||
| Malignancies [ICD9: 140-239; ICD10: C00-C96] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Polycythemia vera [ICD9: 238.4; ICD10: D45] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Rheumatold arthritis; Psoriasis; Diabetic nephropathy [ICD9: 250, 250.4, 580-599, 696, 710-719, 714; ICD10: E08-E13, E10.2, E11.2, E13.2, L40, M00-M25, M05-M06, N00-N29] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Systemic lupus erythematosus [ICD9: 710; ICD10: M32] | |||||
| Function |
Tyrosine kinase of the non-receptor type, involved in theIFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor.
|
||||
| BioChemical Class |
Kinase
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.2
|
||||
| Sequence |
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN DNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN WFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT SFQNLIEGFEALLK |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ruxolitinib | Drug Info | Phase 4 | Essential thrombocythemia | [523729], [541031] |
| ASP-015K | Drug Info | Phase 3 | Psoriasis | [525016], [543066] | |
| Baricitinib | Drug Info | Phase 3 | Rheumatold arthritis; Psoriasis; Diabetic nephropathy | [524953], [542743] | |
| Ruxolitinib | Drug Info | Phase 3 | Pancreatic cancer | [524723], [541031] | |
| ABT-494 | Drug Info | Phase 2 | Rheumatoid arthritis | [525096] | |
| GLPG-0634 | Drug Info | Phase 2 | Rheumatoid arthritis | [524620], [542835] | |
| GSK2586184 | Drug Info | Phase 2 | Systemic lupus erythematosus | [524199] | |
| INCB039110 | Drug Info | Phase 2 | Malignancies | [543090] | |
| Ruxolitinib | Drug Info | Approved | High-risk myelofibrosis | [524601], [533122], [541031], [556264] | |
| INCB47986 | Drug Info | Discontinued in Phase 2 | Rheumatoid arthritis | [549472] | |
| Modulator | ABT-494 | Drug Info | [532777] | ||
| Baricitinib | Drug Info | [532777] | |||
| GLPG-0634 | Drug Info | [532469], [532777] | |||
| GSK2586184 | Drug Info | [533157] | |||
| Ruxolitinib | Drug Info | [531783] | |||
| Inhibitor | ASP-015K | Drug Info | [543544] | ||
| compound 19a | Drug Info | [532598] | |||
| INCB039110 | Drug Info | [543544] | |||
| INCB47986 | Drug Info | [532777] | |||
| WHI-P154 | Drug Info | [529228] | |||
| ZM-39923 | Drug Info | [525732] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | PI3K-Akt signaling pathway | ||||
| Osteoclast differentiation | |||||
| Signaling pathways regulating pluripotency of stem cells | |||||
| Jak-STAT signaling pathway | |||||
| Leishmaniasis | |||||
| Toxoplasmosis | |||||
| Tuberculosis | |||||
| Hepatitis C | |||||
| Hepatitis B | |||||
| Measles | |||||
| Influenza A | |||||
| HTLV-I infection | |||||
| Herpes simplex infection | |||||
| Epstein-Barr virus infection | |||||
| Pathways in cancer | |||||
| Viral carcinogenesis | |||||
| Pancreatic cancer | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| PANTHER Pathway | Angiogenesis | ||||
| Interferon-gamma signaling pathway | |||||
| JAK/STAT signaling pathway | |||||
| PDGF signaling pathway | |||||
| Pathway Interaction Database | p73 transcription factor network | ||||
| IL4-mediated signaling events | |||||
| IL27-mediated signaling events | |||||
| Signaling events mediated by TCPTP | |||||
| SHP2 signaling | |||||
| IL2-mediated signaling events | |||||
| IL2 signaling events mediated by PI3K | |||||
| IFN-gamma pathway | |||||
| IL6-mediated signaling events | |||||
| PDGFR-alpha signaling pathway | |||||
| IL2 signaling events mediated by STAT5 | |||||
| Reactome | Interleukin-6 signaling | ||||
| MAPK3 (ERK1) activation | |||||
| MAPK1 (ERK2) activation | |||||
| GPVI-mediated activation cascade | |||||
| ISG15 antiviral mechanism | |||||
| Interleukin-7 signaling | |||||
| gamma signalling through PI3Kgamma | |||||
| Interleukin-2 signaling | |||||
| RAF/MAP kinase cascade | |||||
| Interferon gamma signaling | |||||
| Regulation of IFNG signaling | |||||
| Interferon alpha/beta signaling | |||||
| Interleukin receptor SHC signaling | |||||
| Regulation of IFNA signaling | |||||
| WikiPathways | Type II interferon signaling (IFNG) | ||||
| Interferon type I signaling pathways | |||||
| TGF Beta Signaling Pathway | |||||
| IL-2 Signaling Pathway | |||||
| IL-4 Signaling Pathway | |||||
| IL-6 signaling pathway | |||||
| TCA Cycle Nutrient Utilization and Invasiveness of Ovarian Cancer | |||||
| IL-3 Signaling Pathway | |||||
| Interleukin-2 signaling | |||||
| Interleukin-7 signaling | |||||
| JAK/STAT | |||||
| PDGF Pathway | |||||
| Oncostatin M Signaling Pathway | |||||
| Interleukin-11 Signaling Pathway | |||||
| Prostate Cancer | |||||
| TSLP Signaling Pathway | |||||
| IL-9 Signaling Pathway | |||||
| Type III interferon signaling | |||||
| IL17 signaling pathway | |||||
| IL-7 Signaling Pathway | |||||
| Leptin signaling pathway | |||||
| TSH signaling pathway | |||||
| Integrated Breast Cancer Pathway | |||||
| Integrated Cancer pathway | |||||
| Interleukin-3, 5 and GM-CSF signaling | |||||
| Interferon gamma signaling | |||||
| Interferon alpha/beta signaling | |||||
| IL-5 Signaling Pathway | |||||
| References | |||||
| Ref 523729 | ClinicalTrials.gov (NCT01493414) INC424 for Patients With Myelofibrosis, Post Polycythemia Myelofibrosis or Post-essential Thrombocythemia Myelofibrosis. U.S. National Institutes of Health. | ||||
| Ref 524199 | ClinicalTrials.gov (NCT01777256) An Adaptive Phase II Study to Evaluate the Efficacy, Pharmacodynamics, Safety and Tolerability of GSK2586184. U.S. National Institutes of Health. | ||||
| Ref 524601 | ClinicalTrials.gov (NCT02038036) Ruxolitinib Efficacy and Safety in Patients With HU Resistant or Intolerant Polycythemia Vera vs Best Available Therapy.. U.S. National Institutes of Health. | ||||
| Ref 524620 | ClinicalTrials.gov (NCT02048618) Efficacy and Safety of GLPG0634 in Subjects With Active Crohn's Disease. U.S. National Institutes of Health. | ||||
| Ref 524723 | ClinicalTrials.gov (NCT02117479) Study of Ruxolitinib in Pancreatic Cancer Patients (Janus 1). U.S. National Institutes of Health. | ||||
| Ref 524953 | ClinicalTrials.gov (NCT02265705) A Study of Baricitinib (LY3009104) in Participants With Rheumatoid Arthritis (RA). U.S. National Institutes of Health. | ||||
| Ref 525016 | ClinicalTrials.gov (NCT02308163) A Study to Evaluate Safety and Efficacy of ASP015K in Patients With Rheumatoid Arthritis (RA) Who Had an Inadequate Response to DMARDs. U.S. National Institutes of Health. | ||||
| Ref 525096 | ClinicalTrials.gov (NCT02365649) A Multicenter, Randomized, Double-Blind, Placebo-Controlled Study of ABT-494 for the Induction of Symptomatic and Endoscopic Remission in Subjects With Moderately to Severely Active Crohn's Disease Who Have Inadequately Responded to or Are Intolerant to Anti-TNF Therapy (Celest Study). U.S. National Institutes of Health. | ||||
| Ref 533122 | Ruxolitinib versus standard therapy for the treatment of polycythemia vera. N Engl J Med. 2015 Jan 29;372(5):426-35. | ||||
| Ref 541031 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5688). | ||||
| Ref 542743 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7792). | ||||
| Ref 542835 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7913). | ||||
| Ref 543066 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8315). | ||||
| Ref 543090 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8364). | ||||
| Ref 525732 | Naphthyl ketones: a new class of Janus kinase 3 inhibitors. Bioorg Med Chem Lett. 2000 Mar 20;10(6):575-9. | ||||
| Ref 529228 | The specificity of JAK3 kinase inhibitors. Blood. 2008 Feb 15;111(4):2155-7. Epub 2007 Dec 19. | ||||
| Ref 532469 | Preclinical characterization of GLPG0634, a selective inhibitor of JAK1, for the treatment of inflammatory diseases. J Immunol. 2013 Oct 1;191(7):3568-77. | ||||
| Ref 532598 | Discovery of 1-methyl-1H-imidazole derivatives as potent Jak2 inhibitors. J Med Chem. 2014 Jan 9;57(1):144-58. | ||||
| Ref 532777 | Selective JAK inhibitors in development for rheumatoid arthritis. Expert Opin Investig Drugs. 2014 Aug;23(8):1067-77. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

