Target General Infomation
Target ID
T68782
Former ID
TTDR00802
Target Name
Prostaglandin D2 receptor
Gene Name
PTGDR
Synonyms
PGD receptor; Prostanoid DP receptor; PTGDR
Target Type
Clinical Trial
Disease Allergy [ICD9: 995.3; ICD10: T78.4]
Asthma [ICD10: J45]
Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4]
Atopic dermatitis [ICD9: 691.8, 692.9; ICD10: L00-L99]
Dyslipidaemias [ICD9: 272; ICD10: E78]
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89]
Rhinitis [ICD9: 472.0, 477; ICD10: J00, J30, J31.0]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Thrombosis [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82]
Thromboembolism [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82]
Function
Receptor for prostaglandin D2 (PGD2). The activity of this receptor is mainly mediated by G(s) proteins that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP. A mobilization of calcium is also observed, but without formation of inositol 1,4,5-trisphosphate (By similarity).
BioChemical Class
GPCR rhodopsin
Target Validation
T68782
UniProt ID
Sequence
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
Drugs and Mode of Action
Drug(s) LAROPIPRANT Drug Info Phase 4 Discovery agent [523049], [540312]
QAW-039 Drug Info Phase 3 Asthma [525329]
AMG 853 Drug Info Phase 2 Asthma [522862]
MK-1029 Drug Info Phase 2 Asthma [523952]
ONO-4053 Drug Info Phase 2 Allergic rhinitis [524158]
S-555739 Drug Info Phase 2 Allergy [551683]
TS-022 Drug Info Phase 2 Atopic dermatitis [522686]
192C86 Drug Info Phase 1 Thrombosis [526857]
SAR-389644 Drug Info Phase 1 Allergic rhinitis [548481]
PGF2alpha Drug Info Clinical trial Solid tumours [532003]
Laropiprant+niacin Drug Info Discontinued in Phase 3 Dyslipidaemias [522926]
S-5751 Drug Info Discontinued in Phase 2 Rhinitis [539197], [547015]
ONO-4127Na Drug Info Discontinued in Phase 1 Allergic rhinitis [547738]
ZK-118182 Drug Info Terminated Thromboembolism [539190], [545456]
Agonist 15-deoxy-Delta12,14-PGJ2 Drug Info [534620]
butaprost (free acid form) Drug Info [525673]
BW 245C Drug Info [534478]
carbacyclin Drug Info [525673]
cloprostenol Drug Info [525673]
Delta12-PGJ2 Drug Info [534620]
L-644,698 Drug Info [525559]
L-888,291 Drug Info [527465]
PGD2 Drug Info [525559]
PGF2alpha Drug Info [525673]
PGJ2 Drug Info [534620]
RS 93520 Drug Info [525753]
SQ-27986 Drug Info [525753]
TS-022 Drug Info [528554]
U46619 Drug Info [525673]
ZK110841 Drug Info [534620]
[3H]PGD2 Drug Info [528126]
Modulator 192C86 Drug Info [544117]
AMG 853 Drug Info
TTH 03-001 Drug Info [543775]
ZK-118182 Drug Info [525716]
Antagonist AH6809 Drug Info [525673]
BWA868C Drug Info [534620]
Laropiprant+niacin Drug Info [536740]
ONO-4053 Drug Info [551636]
ONO-4127Na Drug Info [531930]
ONO-AE3-237 Drug Info [529248]
Prostaglandin D2 antagonists Drug Info [543775]
QAW-039 Drug Info [550305]
S-555739 Drug Info [551683]
S-5751 Drug Info [531635]
SAR-389644 Drug Info [550898]
[3H]BWA868C Drug Info [525913]
Inhibitor DIASTEREOMER 2 Drug Info [528672]
LAROPIPRANT Drug Info [528672]
MK-1029 Drug Info [532493]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Neuroactive ligand-receptor interaction
Pathway Interaction Database Thromboxane A2 receptor signaling
PathWhiz Pathway Intracellular Signalling Through PGD2 receptor and Prostaglandin D2
Reactome Prostanoid ligand receptors
G alpha (s) signalling events
WikiPathways Prostaglandin Synthesis and Regulation
GPCRs, Class A Rhodopsin-like
Small Ligand GPCRs
GPCR ligand binding
GPCR downstream signaling
References
Ref 522686ClinicalTrials.gov (NCT00914186) Study of TS-022 in Adult Patients With Atopic Dermatitis With Pruritus (POC). U.S. National Institutes of Health.
Ref 522862ClinicalTrials.gov (NCT01018550) AMG 853 Phase 2 Study in Subjects With Inadequately Controlled Asthma. U.S. National Institutes of Health.
Ref 522926ClinicalTrials.gov (NCT01054508) Effect of Tredaptive on Serum Lipoproteins and Inflammatory Markers. U.S. National Institutes of Health.
Ref 523049ClinicalTrials.gov (NCT01126073) Niacin/Laropiprant and Endothelial Function. U.S. National Institutes of Health.
Ref 523952ClinicalTrials.gov (NCT01624974) Study to Evaluate the Effectiveness and Safety of MK-1029 in the Treatment of Persistent Asthma That is Not Controlled With Montelukast (ML) in Adults (MK-1029-011 AM2). U.S. National Institutes of Health.
Ref 524158ClinicalTrials.gov (NCT01748344) Phase II Study Evaluating ONO-4053 and Cetirizine in Subjects With Seasonal Allergic Rhinitis. U.S. National Institutes of Health.
Ref 525329ClinicalTrials.gov (NCT02563067) Study of Efficacy and Safety of QAW039 in Patients With Severe Asthma Inadequately Controlled With Standard of Care Asthma Treatment.
Ref 526857The effect of a prostaglandin DP-receptor partial agonist (192C86) on platelet aggregation and the cardiovascular system in healthy volunteers. Br J Clin Pharmacol. 1992 Oct;34(4):344-51.
Ref 532003Stereocontrolled organocatalytic synthesis of prostaglandin PGF2alpha in seven steps. Nature. 2012 Sep 13;489(7415):278-81.
Ref 539190(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1890).
Ref 539197(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1898).
Ref 540312(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3356).
Ref 545456Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003331)
Ref 547015Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012090)
Ref 547738Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018932)
Ref 548481Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025865)
Ref 551683Clinical pipeline report, company report or official report of Shionogi (2011).
Ref 525559A novel biological role for prostaglandin D2 is suggested by distribution studies of the rat DP prostanoid receptor. Eur J Pharmacol. 1999 Jul 14;377(1):101-15.
Ref 525673The utilization of recombinant prostanoid receptors to determine the affinities and selectivities of prostaglandins and related analogs. Biochim Biophys Acta. 2000 Jan 17;1483(2):285-93.
Ref 525716Characterization of prostanoid receptors mediating inhibition of histamine release from anti-IgE-activated rat peritoneal mast cells. Br J Pharmacol. 2000 Feb;129(3):589-97.
Ref 525753Affinities, selectivities, potencies, and intrinsic activities of natural and synthetic prostanoids using endogenous receptors: focus on DP class prostanoids. J Pharmacol Exp Ther. 2000 May;293(2):321-8.
Ref 525913Pharmacology and autoradiography of human DP prostanoid receptors using [(3)H]-BWA868C, a DP receptor-selective antagonist radioligand. Br J Pharmacol. 2000 Nov;131(6):1025-38.
Ref 527465Identification of a potent and selective synthetic agonist at the CRTH2 receptor. Mol Pharmacol. 2005 Jun;67(6):1834-9. Epub 2005 Mar 8.
Ref 528126GW627368X ((N-{2-[4-(4,9-diethoxy-1-oxo-1,3-dihydro-2H-benzo[f]isoindol-2-yl)phenyl]acetyl} benzene sulphonamide): a novel, potent and selective prostanoid EP4 receptor antagonist. Br J Pharmacol. 2006 Jun;148(3):326-39.
Ref 528554Effects of TS-022, a newly developed prostanoid DP1 receptor agonist, on experimental pruritus, cutaneous barrier disruptions and atopic dermatitis in mice. Eur J Pharmacol. 2007 Feb 5;556(1-3):207-14. Epub 2006 Nov 3.
Ref 528672J Med Chem. 2007 Feb 22;50(4):794-806.Discovery of a potent and selective prostaglandin D2 receptor antagonist, [(3R)-4-(4-chloro-benzyl)-7-fluoro-5-(methylsulfonyl)-1,2,3,4-tetrahydrocyclopenta[b]indol-3-yl]-acetic acid (MK-0524).
Ref 529248Prostaglandin D2 inhibits the production of IFN-gamma by invariant NK T cells: consequences in the control of B16 melanoma. J Immunol. 2008 Jan 15;180(2):783-92.
Ref 531635Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36.
Ref 531930Sleep-wake regulation by prostaglandin D2 and adenosine. Brain Nerve. 2012 Jun;64(6):621-8.
Ref 532493Update on the status of DP2 receptor antagonists; from proof of concept through clinical failures to promising new drugs. Expert Opin Investig Drugs. 2014 Jan;23(1):55-66.
Ref 534478Ligand binding specificities of the eight types and subtypes of the mouse prostanoid receptors expressed in Chinese hamster ovary cells. Br J Pharmacol. 1997 Sep;122(2):217-24.
Ref 534620Characterization of the recombinant human prostanoid DP receptor and identification of L-644,698, a novel selective DP agonist. Br J Pharmacol. 1998 Apr;123(7):1317-24.
Ref 536740Emerging antidyslipidemic drugs. Expert Opin Emerg Drugs. 2008 Jun;13(2):363-81.
Ref 543775(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 338).
Ref 544117Prostanoid receptor antagonists: development strategies and therapeutic applications. Br J Pharmacol. 2009 September; 158(1): 104-145.
Ref 550305Effect Of QAW039, An Oral Prostaglandin D2 Receptor (DP2/CRTh2) Antagonist, Upon Sputum And Bronchial Eosinophilic Inflammation And Clinical Outcomes In Treatment-Resistant Asthma: A Phase 2a Randomized Placebo-Controlled Trial. American Thoracic Society Journals. 2015.
Ref 550898US patent application no. 2008,0300,217, Combination therapy with fumaric acid esters for the treatment of autoimmune and,or inflammatory disorders.
Ref 551636Effect of ONO-4053, a DP1 (prostaglandin D2 receptor) Antagonist, on Prostaglandin D2-Induced Nasal Congestion. Journal of Allergy and Clinical Immunology Volume 135, Issue 2, Supplement, February 2015, Pages AB219.
Ref 551683Clinical pipeline report, company report or official report of Shionogi (2011).

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.