Target General Infomation
Target ID
T72702
Former ID
TTDR00396
Target Name
Tissue factor
Gene Name
F3
Synonyms
CD142 antigen; Coagulation factor III; TF; Thromboplastin; F3
Target Type
Clinical Trial
Disease Adult respiratory distress syndrome [ICD9: 518.5, 518.82; ICD10: J80]
Bleeding [ICD9: 444, 453; ICD10: I74, I80-I82]
Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25]
Function
Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assemblyand propagation of the coagulation protease cascade.
BioChemical Class
Transmembrane protein
Target Validation
T72702
UniProt ID
Sequence
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS
AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG
KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE
CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS
Drugs and Mode of Action
Drug(s) ALT-836 Drug Info Phase 2 Adult respiratory distress syndrome [522632]
TT-173 Drug Info Phase 2 Bleeding [524568]
MORAb-066 Drug Info Phase 1 Pancreatic cancer [524176]
Inhibitor ALT-836 Drug Info [533187]
D-Pro-Phe-Arg chloromethyl ketone Drug Info [529454]
Modulator TT-173 Drug Info [533319]
Pathways
KEGG Pathway Complement and coagulation cascades
NetPath Pathway IL4 Signaling Pathway
TGF_beta_Receptor Signaling Pathway
TWEAK Signaling Pathway
PANTHER Pathway Angiogenesis
Blood coagulation
PathWhiz Pathway Coagulation
Reactome Extrinsic Pathway of Fibrin Clot Formation
WikiPathways Complement and Coagulation Cascades
Formation of Fibrin Clot (Clotting Cascade)
References
Ref 522632ClinicalTrials.gov (NCT00879606) Anti-TF Antibody (ALT-836) to Treat Septic Patients With Acute Lung Injury or Acute Respiratory Distress Syndrome. U.S. National Institutes of Health.
Ref 524176ClinicalTrials.gov (NCT01761240) Dose Escalation Study MORAb-066 Targeting TF-expressing Malignancies Including Breast, Pancreatic, Colorectal, NSCLC. U.S. National Institutes of Health.
Ref 524568ClinicalTrials.gov (NCT02012569) Determine the Haemostatic Efficacy of TT-173, Reducing the Bleeding Time in the Donor Site of Skin Grafting. U.S. National Institutes of Health.
Ref 529454J Med Chem. 2008 Jun 12;51(11):3077-80. Epub 2008 May 7.Novel 3-carboxamide-coumarins as potent and selective FXIIa inhibitors.
Ref 533187ImmunoPET of tissue factor expression in triple-negative breast cancer with a radiolabeled antibody Fab fragment. Eur J Nucl Med Mol Imaging. 2015 Jul;42(8):1295-303.
Ref 533319TETIS study: evaluation of new topical hemostatic agent TT-173 in tooth extraction. Clin Oral Investig. 2015 Sep 15.
Ref 551163Clinical pipeline report, company report or official report of Morphotek.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.