Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T86350
|
||||
| Former ID |
TTDR01265
|
||||
| Target Name |
Receptor protein-tyrosine kinase erbB-3
|
||||
| Gene Name |
ERBB3
|
||||
| Synonyms |
C-erbB-3 protein; C-erbB3; Tyrosine kinase-type cell surface receptor HER3; ERBB3
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Colorectal cancer; Head and neck cancer [ICD9: 140-149, 153, 154; ICD10: C18-C21, C07-C14, C32-C33] | |||||
| Late-stage solid tumors [ICD9: 140-199, 210-229; ICD10: C00-C75, C7A, C7B, D10-D36, D3A] | |||||
| Metastatic epithelial tumors [ICD9: 140-199; ICD10: C00-C75, C7A, C7B] | |||||
| Non-small cell lung cancer [ICD10: C33-C34] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Binds and is activated by neuregulins and NTAK. May also be activated by CSPG5.
|
||||
| BioChemical Class |
Kinase
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.1
|
||||
| Sequence |
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG RSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD SAFDNPDYWHSRLFPKANAQRT |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Elisidepsin | Drug Info | Phase 2 | Psoriasis | [533234] |
| MEHD-7945A | Drug Info | Phase 2 | Solid tumours | [523994] | |
| MEHD7945A | Drug Info | Phase 2 | Colorectal cancer; Head and neck cancer | [523994], [889373] | |
| MM-121 | Drug Info | Phase 2 | Breast cancer | [523649] | |
| MM-141 | Drug Info | Phase 2 | Cancer | [525130] | |
| AMG888/U3-1287 | Drug Info | Phase 1/2 | Non-small cell lung cancer | [523187] | |
| LJM716 | Drug Info | Phase 1/2 | Breast cancer | [524764] | |
| Anti-HER3/EGFR DAF | Drug Info | Phase 1 | Metastatic epithelial tumors | [550794] | |
| AV-203 | Drug Info | Phase 1 | Cancer | [523911] | |
| Drug 2849330 | Drug Info | Phase 1 | Cancer | [524480] | |
| GSK2849330 | Drug Info | Phase 1 | Cancer | [524480] | |
| KTN3379 | Drug Info | Phase 1 | Late-stage solid tumors | [524573] | |
| MM-151 | Drug Info | Phase 1 | Solid tumours | [549340] | |
| Patritumab | Drug Info | Phase 1 | Non-small cell lung cancer | [524459] | |
| Recombinant human Erbb3 fragment therapeutic tumor vaccine | Drug Info | Phase 1 | Cancer | [551788] | |
| REGN1400 | Drug Info | Phase 1 | Cancer | [549420] | |
| RG7116 | Drug Info | Phase 1 | Solid tumours | [549350] | |
| Modulator | AMG888/U3-1287 | Drug Info | [543486] | ||
| Anti-HER3/EGFR DAF | Drug Info | ||||
| MEHD-7945A | Drug Info | ||||
| MEHD7945A | Drug Info | [889442] | |||
| MM-121 | Drug Info | ||||
| MM-141 | Drug Info | [532567] | |||
| MM-151 | Drug Info | [532567] | |||
| RG7116 | Drug Info | [532402] | |||
| SYM-011 | Drug Info | [543486] | |||
| Inhibitor | Elisidepsin | Drug Info | [530057] | ||
| Soluble ErbB3 theragnostics | Drug Info | [543486] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | ErbB signaling pathway | ||||
| Calcium signaling pathway | |||||
| Endocytosis | |||||
| Proteoglycans in cancer | |||||
| MicroRNAs in cancer | |||||
| NetPath Pathway | TNFalpha Signaling Pathway | ||||
| PANTHER Pathway | Cadherin signaling pathway | ||||
| EGF receptor signaling pathway | |||||
| Pathway Interaction Database | ErbB2/ErbB3 signaling events | ||||
| ErbB receptor signaling network | |||||
| a6b1 and a6b4 Integrin signaling | |||||
| WikiPathways | ErbB Signaling Pathway | ||||
| Apoptosis-related network due to altered Notch3 in ovarian cancer | |||||
| Signaling Pathways in Glioblastoma | |||||
| miR-targeted genes in muscle cell - TarBase | |||||
| Heart Development | |||||
| References | |||||
| Ref 523187 | ClinicalTrials.gov (NCT01211483) Study of Erlotinib With or Without Investigational Drug (U3-1287) in Subjects With Advanced Non-small Cell Lung Cancer. U.S. National Institutes of Health. | ||||
| Ref 523649 | ClinicalTrials.gov (NCT01447706) A Study of MM-121 With Paclitaxel in Platinum Resistant/ Refractory Advanced Ovarian Cancers. U.S. National Institutes of Health. | ||||
| Ref 523911 | ClinicalTrials.gov (NCT01603979) A Phase 1 Dose Escalation Study of AV-203, an ERBB3 Inhibitory Antibody, in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 523994 | ClinicalTrials.gov (NCT01652482) A Study of MEHD7945A + FOLFIRI Versus Cetuximab + FOLFIRI in Second Line in Patients With KRAS Wild-Type Metastatic Colorectal Cancer. U.S. National Institutes of Health. | ||||
| Ref 524459 | ClinicalTrials.gov (NCT01957280) Study to Assess Pharmacokinetics, Immunogenicity and Safety/Tolerability of Patritumab (U3-1287). U.S. National Institutes of Health. | ||||
| Ref 524480 | ClinicalTrials.gov (NCT01966445) Dose Escalation Study to Investigate the Safety, Pharmacokinetics, and Pharmacodynamics of GSK2849330 in Subjects With Advanced Her3-Positive Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 524573 | ClinicalTrials.gov (NCT02014909) A Phase 1 Study to Evaluate the Safety and Pharmacokinetics of KTN3379 in Adult Subjects With Advanced Tumors. U.S. National Institutes of Health. | ||||
| Ref 524764 | ClinicalTrials.gov (NCT02143622) Study of Efficacy and Safety of LJM716 and Cetuximab in Head and Neck Squamous Cell Carcinoma Patients. U.S. National Institutes of Health. | ||||
| Ref 525130 | ClinicalTrials.gov (NCT02399137) A Phase 2 Study of MM-141 Plus Nab-paclitaxel and Gemcitabine in Front-line Metastatic Pancreatic Cancer. U.S. National Institutes of Health. | ||||
| Ref 533234 | First-in-human, phase I study of elisidepsin (PM02734) administered as a 30-min or as a 3-hour intravenous infusion every three weeks in patients with advanced solid tumors. Invest New Drugs. 2015 Aug;33(4):901-10. | ||||
| Ref 549340 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035447) | ||||
| Ref 549350 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035594) | ||||
| Ref 530057 | Molecular pharmacodynamics of PM02734 (elisidepsin) as single agent and in combination with erlotinib; synergistic activity in human non-small cell lung cancer cell lines and xenograft models. Eur J Cancer. 2009 Jul;45(10):1855-64. | ||||
| Ref 531635 | Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36. | ||||
| Ref 532402 | RG7116, a therapeutic antibody that binds the inactive HER3 receptor and is optimized for immune effector activation. Cancer Res. 2013 Aug 15;73(16):5183-94. | ||||
| Ref 532451 | An antibody that locks HER3 in the inactive conformation inhibits tumor growth driven by HER2 or neuregulin. Cancer Res. 2013 Oct 1;73(19):6024-35. | ||||
| Ref 532567 | MM-141, an IGF-IR- and ErbB3-directed bispecific antibody, overcomes network adaptations that limit activity of IGF-IR inhibitors. Mol Cancer Ther. 2014 Feb;13(2):410-25. | ||||
| Ref 532632 | Phase 1 and dose-finding study of patritumab (U3-1287), a human monoclonal antibody targeting HER3, in Japanese patients with advanced solid tumors. Cancer Chemother Pharmacol. 2014 Mar;73(3):511-6. | ||||
| Ref 533093 | Neuregulin 1 expression is a predictive biomarker for response to AV-203, an ERBB3 inhibitory antibody, in human tumor models. Clin Cancer Res. 2015 Mar 1;21(5):1106-14. | ||||
| Ref 543486 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1798). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

