Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T87023
|
||||
| Former ID |
TTDR01165
|
||||
| Target Name |
Platelet-activating factor receptor
|
||||
| Gene Name |
PTAFR
|
||||
| Synonyms |
PAF-R; PTAFR
|
||||
| Target Type |
Successful
|
||||
| Disease | Asthma [ICD10: J45] | ||||
| Allergy [ICD9: 995.3; ICD10: T78.4] | |||||
| Brain ischaemia [ICD9: 435, 437; ICD10: G45.9, I67.8] | |||||
| Conjunctivitis [ICD9: 372; ICD10: H10] | |||||
| Cerebral infarction [ICD10: I63] | |||||
| Cardiac arrhythmias [ICD9: 427; ICD10: I47-I49] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
| Nerve injury [ICD10: T14.4] | |||||
| Ocular allergy [ICD9: 360-379; ICD10: H00-H59] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Stroke [ICD9: 434.91, 437.6, 453, 671.5, 671.9; ICD10: I61-I63, I80-I82] | |||||
| Septic shock [ICD9: 785.52; ICD10: A41.9] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Thromboembolism [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82] | |||||
| Thrombocytopenia [ICD9: 287.3, 287.4, 287.5; ICD10: D69.6, P61.0] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth- muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol- calcium second messenger system.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T87023
|
||||
| UniProt ID | |||||
| Sequence |
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ticlopidine | Drug Info | Approved | Stroke | [536186], [542329] |
| RUPATADINE | Drug Info | Phase 4 | Discovery agent | [521763] | |
| ISRAPAFANT | Drug Info | Phase 3 | Asthma | [539166], [544953] | |
| CMI-392 | Drug Info | Phase 2 | Psoriasis | [526130] | |
| Dersalazine | Drug Info | Phase 2 | Inflammatory bowel disease | [544223] | |
| Lexipafant | Drug Info | Phase 2 | Nerve injury | [533596] | |
| YM-264 | Drug Info | Phase 2 | Septic shock | [551827] | |
| BN 50730 | Drug Info | Discontinued in Phase 3 | Asthma | [544860] | |
| FOROPAFANT | Drug Info | Discontinued in Phase 3 | Asthma | [539165], [545088] | |
| BN50727 | Drug Info | Discontinued in Phase 2 | Inflammatory bowel disease | [545900] | |
| DE-081 | Drug Info | Discontinued in Phase 2 | Conjunctivitis | [544551] | |
| E-6123 | Drug Info | Discontinued in Phase 2 | Asthma | [544861] | |
| Minopafant | Drug Info | Discontinued in Phase 2 | Septic shock | [545101] | |
| MK-287 | Drug Info | Discontinued in Phase 2 | Septic shock | [544956] | |
| Ro-24-4736 | Drug Info | Discontinued in Phase 2 | Septic shock | [544808] | |
| SM-10661 | Drug Info | Discontinued in Phase 2 | Septic shock | [545724] | |
| TCV-309 | Drug Info | Discontinued in Phase 2 | Septic shock | [545100] | |
| UK-74505 | Drug Info | Discontinued in Phase 2 | Septic shock | [544958] | |
| ABT-299 | Drug Info | Discontinued in Phase 1 | Septic shock | [539158], [545958] | |
| AGN-191743 | Drug Info | Discontinued in Phase 1 | Allergy | [545538] | |
| DACOPAFANT | Drug Info | Discontinued in Phase 1 | Septic shock | [544523] | |
| DF-1111301 | Drug Info | Discontinued in Phase 1 | Allergy | [545558] | |
| SDZ-62-434 | Drug Info | Discontinued in Phase 1 | Solid tumours | [545067] | |
| Apafant | Drug Info | Terminated | Ocular allergy | [536119], [539170] | |
| Bepafant | Drug Info | Terminated | Septic shock | [541324], [544548] | |
| BN-50726 | Drug Info | Terminated | Nerve injury | [544993] | |
| BN50739 | Drug Info | Terminated | Cerebral infarction | [539160], [545069] | |
| BN52021 | Drug Info | Terminated | Septic shock | [539172], [544554] | |
| CL-184005 | Drug Info | Terminated | Septic shock | [544950] | |
| CMI-206 | Drug Info | Terminated | Inflammatory disease | [551572] | |
| CV 6209 | Drug Info | Terminated | Asthma | [539161], [544844] | |
| FR-128998 | Drug Info | Terminated | Thrombocytopenia | [545711] | |
| KC-11404 | Drug Info | Terminated | Asthma | [533776] | |
| KC-11425 | Drug Info | Terminated | Asthma | [545947] | |
| L-659989 | Drug Info | Terminated | Discovery agent | [540368], [545703] | |
| Ro-24-0238 | Drug Info | Terminated | Septic shock | [545571] | |
| SCH-37370 | Drug Info | Terminated | Discovery agent | [544522] | |
| Sch-40338 | Drug Info | Terminated | Allergy | [529095], [539163] | |
| SDZ-64-412 | Drug Info | Terminated | Discovery agent | [539164], [544521] | |
| TIAPAFANT | Drug Info | Terminated | Septic shock | [541326], [545057] | |
| TULOPAFANT | Drug Info | Terminated | Cardiac arrhythmias | [544829] | |
| UR-12460 | Drug Info | Terminated | Thromboembolism | [545849] | |
| WEB-2347 | Drug Info | Terminated | Allergy | [544959] | |
| Antagonist | 10-OBn-7alpha-F-gingkolide B | Drug Info | [526536] | ||
| 10-OBn-epi-ginkgolide C | Drug Info | [526536] | |||
| 10-OBn-ginkgolide B | Drug Info | [526536] | |||
| 10-OBn-ginkgolide C | Drug Info | [526536] | |||
| 7-epi-ginkgolide C | Drug Info | [526536] | |||
| 7alpha-Cl-ginkgolide B | Drug Info | [526536] | |||
| 7alpha-F-ginkgolide B | Drug Info | [526536] | |||
| 7alpha-N3-ginkgolide B | Drug Info | [526536] | |||
| 7alpha-NH2-ginkgolide B | Drug Info | [526536] | |||
| 7alpha-NHEt-ginkgolide B | Drug Info | [526536] | |||
| 7alpha-NHMe-ginkgolide B | Drug Info | [526536] | |||
| 7alpha-OAc-ginkgolide B | Drug Info | [526536] | |||
| 7alpha-OCOCH2Ph-ginkgolide B | Drug Info | [526536] | |||
| ABT-299 | Drug Info | [534237] | |||
| Apafant | Drug Info | [536119] | |||
| Bepafant | Drug Info | [531921] | |||
| BN-50726 | Drug Info | [526932] | |||
| CV-3988 | Drug Info | [533398] | |||
| DACOPAFANT | Drug Info | [531635], [532945] | |||
| DF-1111301 | Drug Info | [531635], [550948] | |||
| FOROPAFANT | Drug Info | [525756], [528090], [531635] | |||
| ISRAPAFANT | Drug Info | [530579], [531635] | |||
| KC-11425 | Drug Info | [551926] | |||
| LAU-0901 | Drug Info | [529694], [531839] | |||
| Minopafant | Drug Info | [527485] | |||
| MK-287 | Drug Info | [531635], [534027] | |||
| Ro-24-4736 | Drug Info | [528091] | |||
| RP-52770 | Drug Info | [533359] | |||
| SDZ-62-434 | Drug Info | [531635], [534010] | |||
| SM-10661 | Drug Info | [531635], [534276] | |||
| TIAPAFANT | Drug Info | [531635], [533646] | |||
| TULOPAFANT | Drug Info | [531635], [534023] | |||
| UK-74505 | Drug Info | [533761] | |||
| YM-264 | Drug Info | [530793] | |||
| [3H]52770 RP | Drug Info | [533359] | |||
| [3H]apafant | Drug Info | [533649] | |||
| Agonist | 2-O-ethyl-PAF C-16 | Drug Info | [533649] | ||
| 2-O-methyl-PAF C-18 | Drug Info | [533649] | |||
| enantio PAF C-16 | Drug Info | [533649] | |||
| methylcarbamyl PAF | Drug Info | [543773] | |||
| PAF | Drug Info | [534204] | |||
| [3H]PAF | Drug Info | [526143] | |||
| Modulator | A 137491 | Drug Info | [538075] | ||
| AGN-191743 | Drug Info | [550918] | |||
| BB-823 | Drug Info | [533626] | |||
| BN 50730 | Drug Info | ||||
| BN50727 | Drug Info | ||||
| BN50739 | Drug Info | ||||
| BN52021 | Drug Info | ||||
| CL-184005 | Drug Info | ||||
| CMI-206 | Drug Info | ||||
| CMI-392 | Drug Info | [526130] | |||
| CV 6209 | Drug Info | ||||
| DE-081 | Drug Info | [534251] | |||
| E-6123 | Drug Info | ||||
| FR-128998 | Drug Info | [533881] | |||
| FR-900452 | Drug Info | ||||
| KC-11404 | Drug Info | [533776] | |||
| KO-286011 | Drug Info | ||||
| Lexipafant | Drug Info | ||||
| SCH-37370 | Drug Info | [529095] | |||
| Sch-40338 | Drug Info | ||||
| SRI-63-675 | Drug Info | ||||
| TCV-309 | Drug Info | ||||
| Ticlopidine | Drug Info | [556264] | |||
| UR-10324 | Drug Info | ||||
| UR-11353 | Drug Info | ||||
| UR-12460 | Drug Info | [533626] | |||
| UR-12510 | Drug Info | [550919] | |||
| UR-12519 | Drug Info | ||||
| WEB-2347 | Drug Info | [529756] | |||
| Inhibitor | Dersalazine | Drug Info | [544223] | ||
| L-652731 | Drug Info | [526814] | |||
| L-659989 | Drug Info | [526814] | |||
| Platelet activating factor receptor inhibitors | Drug Info | [543773] | |||
| Ro-24-0238 | Drug Info | [533343] | |||
| RUPATADINE | Drug Info | [527799] | |||
| SDZ-64-412 | Drug Info | [533935] | |||
| VERAGUENSIN | Drug Info | [526814] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Calcium signaling pathway | ||||
| Neuroactive ligand-receptor interaction | |||||
| Staphylococcus aureus infection | |||||
| NetPath Pathway | IL5 Signaling Pathway | ||||
| Leptin Signaling Pathway | |||||
| Reactome | Class A/1 (Rhodopsin-like receptors) | ||||
| G alpha (q) signalling events | |||||
| Interferon gamma signaling | |||||
| WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| Small Ligand GPCRs | |||||
| Interferon gamma signaling | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 521763 | ClinicalTrials.gov (NCT00258141) Study With Rupatadine in Mosquito-Bite Allergic Adult Subjects. U.S. National Institutes of Health. | ||||
| Ref 526130 | Anti-inflammatory activities of LDP-392, a dual PAF receptor antagonist and 5-lipoxygenase inhibitor. Pharmacol Res. 2001 Sep;44(3):213-20. | ||||
| Ref 529095 | Sch 37370: a new drug combining antagonism of platelet-activating factor (PAF) with antagonism of histamine. Agents Actions Suppl. 1991;34:313-21. | ||||
| Ref 533596 | Randomized, double-blind phase II trial of Lexipafant, a platelet-activating factor antagonist, in human acute pancreatitis. Br J Surg. 1995 Oct;82(10):1414-20. | ||||
| Ref 533776 | Synthesis, structure-activity relationships, and pharmacological evaluation of pyrrolo[3,2,1-ij]quinoline derivatives: potent histamine and platelet activating factor antagonism and 5-lipoxygenase inhibitory properties. Potential therapeutic application in asthma. J Med Chem. 1995 Feb 17;38(4):669-85. | ||||
| Ref 536186 | Emerging drugs in peripheral arterial disease. Expert Opin Emerg Drugs. 2006 Mar;11(1):75-90. | ||||
| Ref 539158 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1849). | ||||
| Ref 539160 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1851). | ||||
| Ref 539161 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1852). | ||||
| Ref 539163 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1854). | ||||
| Ref 539164 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1855). | ||||
| Ref 539165 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1856). | ||||
| Ref 539166 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1857). | ||||
| Ref 539170 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1860). | ||||
| Ref 539172 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1862). | ||||
| Ref 540368 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3426). | ||||
| Ref 541324 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6078). | ||||
| Ref 541326 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6080). | ||||
| Ref 542329 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7307). | ||||
| Ref 544223 | The intestinal anti-inflammatory effect of dersalazine sodium is related to a down-regulation in IL-17 production in experimental models of rodent colitis. Br J Pharmacol. 2012 February; 165(3): 729-740. | ||||
| Ref 544521 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000046) | ||||
| Ref 544522 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000047) | ||||
| Ref 544523 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000051) | ||||
| Ref 544548 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000108) | ||||
| Ref 544551 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000113) | ||||
| Ref 544554 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000117) | ||||
| Ref 544808 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001180) | ||||
| Ref 544829 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001254) | ||||
| Ref 544844 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001311) | ||||
| Ref 544860 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001346) | ||||
| Ref 544861 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001351) | ||||
| Ref 544950 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001674) | ||||
| Ref 544953 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001699) | ||||
| Ref 544956 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001713) | ||||
| Ref 544958 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001719) | ||||
| Ref 544959 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001720) | ||||
| Ref 544993 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001821) | ||||
| Ref 545057 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001989) | ||||
| Ref 545067 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002021) | ||||
| Ref 545069 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002032) | ||||
| Ref 545088 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002078) | ||||
| Ref 545100 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002130) | ||||
| Ref 545101 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002131) | ||||
| Ref 545538 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003636) | ||||
| Ref 545558 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003701) | ||||
| Ref 545571 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003729) | ||||
| Ref 545703 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004265) | ||||
| Ref 545711 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004313) | ||||
| Ref 545724 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004382) | ||||
| Ref 545849 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005037) | ||||
| Ref 545900 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005290) | ||||
| Ref 545947 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005461) | ||||
| Ref 545958 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005514) | ||||
| Ref 525756 | In vitro inhibitory effect of SR 27417, a potent platelet-activating factor (PAF) receptor antagonist, on the PAF-induced bovine platelet aggregation. Vet Res. 2000 Mar-Apr;31(2):267-72. | ||||
| Ref 526130 | Anti-inflammatory activities of LDP-392, a dual PAF receptor antagonist and 5-lipoxygenase inhibitor. Pharmacol Res. 2001 Sep;44(3):213-20. | ||||
| Ref 526143 | Single nucleotide polymorphism of human platelet-activating factor receptor impairs G-protein activation. J Biol Chem. 2001 Nov 16;276(46):43025-30. Epub 2001 Sep 17. | ||||
| Ref 526536 | Preparation of 7-substituted ginkgolide derivatives: potent platelet activating factor (PAF) receptor antagonists. J Med Chem. 2003 Feb 13;46(4):601-8. | ||||
| Ref 526814 | J Med Chem. 1992 Sep 18;35(19):3474-82.Development, synthesis, and biological evaluation of (-)-trans-(2S,5S)-2-[3-[(2-oxopropyl)sulfonyl]-4-n-propoxy-5-(3- hydroxypropoxy)-phenyl]-5-(3,4,5-trimethoxyphenyl)tetrahydrofuran, a potent orally active platelet-activating factor (PAF) antagonist and its water-soluble prodrug phosphate ester. | ||||
| Ref 526932 | Effects of the PAF antagonists BN50726 and BN50739 on arrhythmogenesis and extent of necrosis during myocardial ischaemia/reperfusion in rabbits. Br J Pharmacol. 1992 Nov;107(3):705-9. | ||||
| Ref 527485 | Formation of spherical micelles composed of the novel platelet activating factor receptor antagonist, E5880. Pharm Dev Technol. 2005;10(1):11-6. | ||||
| Ref 527799 | J Med Chem. 2005 Oct 20;48(21):6523-43.Designed multiple ligands. An emerging drug discovery paradigm. | ||||
| Ref 528090 | Biochemical and pharmacological activities of SR 27417, a highly potent, long-acting platelet-activating factor receptor antagonist. J Pharmacol Exp Ther. 1991 Oct;259(1):44-51. | ||||
| Ref 528091 | Pharmacology of a potent platelet-activating factor antagonist: Ro 24-4736. J Pharmacol Exp Ther. 1991 Oct;259(1):78-85. | ||||
| Ref 529095 | Sch 37370: a new drug combining antagonism of platelet-activating factor (PAF) with antagonism of histamine. Agents Actions Suppl. 1991;34:313-21. | ||||
| Ref 529694 | LAU-0901, a novel platelet-activating factor antagonist, is highly neuroprotective in cerebral ischemia. Exp Neurol. 2008 Dec;214(2):253-8. | ||||
| Ref 529756 | WEB 2347: pharmacology of a new very potent and long acting hetrazepinoic PAF-antagonist and its action in repeatedly sensitized guinea-pigs. J Lipid Mediat. 1991 Jul-Aug;4(1):39-44. | ||||
| Ref 530579 | Amino acid residues critical for endoplasmic reticulum export and trafficking of platelet-activating factor receptor. J Biol Chem. 2010 Feb 19;285(8):5931-40. | ||||
| Ref 530793 | Effects of YM264, a novel PAF antagonist, on puromycin aminonucleoside-induced nephropathy in the rat. Biochem Biophys Res Commun. 1991 Apr 30;176(2):781-5. | ||||
| Ref 531635 | Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36. | ||||
| Ref 531839 | Superior Neuroprotective Efficacy of LAU-0901, a Novel Platelet-Activating Factor Antagonist, in Experimental Stroke. Transl Stroke Res. 2012 Mar;3(1):154-63. | ||||
| Ref 531921 | Pharmacologic activity of bepafant (WEB 2170), a new and selective hetrazepinoic antagonist of platelet activating factor. J Pharmacol Exp Ther. 1990 Dec;255(3):962-8. | ||||
| Ref 532945 | RP 55778, a PAF receptor antagonist, prevents and reverses LPS-induced hemoconcentration and TNF release. J Lipid Mediat. 1989 Nov-Dec;1(6):349-60. | ||||
| Ref 533343 | J Med Chem. 1989 Aug;32(8):1820-35.Pentadienyl carboxamide derivatives as antagonists of platelet-activating factor. | ||||
| Ref 533359 | [3H]52770 RP, a platelet-activating factor receptor antagonist, and tritiated platelet-activating factor label a common specific binding site in human polymorphonuclear leukocytes. J Pharmacol Exp Ther. 1988 Feb;244(2):709-15. | ||||
| Ref 533398 | Inhibition by CV-3988 of the binding of [3H]-platelet activating factor (PAF) to the platelet. Biochem Pharmacol. 1985 May 1;34(9):1491-5. | ||||
| Ref 533626 | Platelet-activating factor: the effector of protein-rich plasma extravasation and nitric oxide synthase induction in rat immune complex peritonitis. Br J Pharmacol. 1995 Feb;114(4):895-901. | ||||
| Ref 533646 | PCA-4248, a PAF receptor antagonist, inhibits PAF-induced phosphoinositide turnover. Eur J Pharmacol. 1995 Aug 15;290(3):183-8. | ||||
| Ref 533649 | A radioreceptor binding assay for platelet-activating factor (PAF) using membranes from CHO cells expressing human PAF receptor. J Immunol Methods. 1995 Oct 26;186(2):225-31. | ||||
| Ref 533761 | Differential effects of the PAF receptor antagonist UK-74,505 on neutrophil and eosinophil accumulation in guinea-pig skin. Br J Pharmacol. 1994 Oct;113(2):513-21. | ||||
| Ref 533776 | Synthesis, structure-activity relationships, and pharmacological evaluation of pyrrolo[3,2,1-ij]quinoline derivatives: potent histamine and platelet activating factor antagonism and 5-lipoxygenase inhibitory properties. Potential therapeutic application in asthma. J Med Chem. 1995 Feb 17;38(4):669-85. | ||||
| Ref 533881 | Effect of FR128998, a novel PAF receptor antagonist, on endotoxin-induced disseminated intravascular coagulation. Eur J Pharmacol. 1994 Jun 13;258(3):239-46. | ||||
| Ref 533935 | J Med Chem. 1993 Oct 15;36(21):3098-102.Structural modification of 5-aryl-2,3-dihydroimidazo[2,1-a]isoquinoline platelet activating factor receptor antagonists. | ||||
| Ref 534010 | In vitro antitumour activity of the novel imidazoisoquinoline SDZ 62-434. Br J Cancer. 1993 May;67(5):989-95. | ||||
| Ref 534023 | Tulopafant, a PAF receptor antagonist, increases capillary patency and prolongs survival in discordant cardiac xenotransplants. J Lipid Mediat. 1993 May;7(1):79-84. | ||||
| Ref 534027 | MK 287: a potent, specific, and orally active receptor antagonist of platelet-activating factor. J Lipid Mediat. 1993 Jun;7(2):115-34. | ||||
| Ref 534204 | Identification of transmembrane domain residues determinant in the structure-function relationship of the human platelet-activating factor receptor by site-directed mutagenesis. J Biol Chem. 1996 Sep20;271(38):23298-303. | ||||
| Ref 534237 | ABT-299, a novel PAF antagonist, attenuates multiple effects of endotoxemia in conscious rats. Shock. 1996 Aug;6(2):112-7. | ||||
| Ref 534251 | J Pharmacol Toxicol Methods. 1996 Sep;36(1):53-62.Characterization of [3H]apafant binding to PAF receptor on rabbit platelet membranes: a comparison of a microplate filtration system and a standard method. | ||||
| Ref 534276 | Effect of the PAF-receptor antagonist SM-12502 on human platelets. Inflammation. 1996 Feb;20(1):71-85. | ||||
| Ref 538075 | The role of platelet-activating factor (PAF) and the efficacy of ABT-491, a highly potent and selective PAF antagonist, in experimental allergic rhinitis. J Pharmacol Exp Ther. 1998 Jan;284(1):83-8. | ||||
| Ref 543773 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 334). | ||||
| Ref 544223 | The intestinal anti-inflammatory effect of dersalazine sodium is related to a down-regulation in IL-17 production in experimental models of rodent colitis. Br J Pharmacol. 2012 February; 165(3): 729-740. | ||||
| Ref 550918 | US patent application no. 6,274,627, Conjugates of dithiocarbamate disulfides with pharmacologically active agents and uses therefor. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

