Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T87024
|
||||
| Former ID |
TTDC00180
|
||||
| Target Name |
Amyloid beta A4 protein
|
||||
| Gene Name |
APP
|
||||
| Synonyms |
ABPP; APPI; Alzheimer's disease amyloid protein; Amyloid beta precursor protein; Amyloid precursor protein; Beta-amyloid peptide; CVAP; Cerebral vascular amyloidpeptide; Gamma-Secretase; PN-II; PreA4; Protease nexin-II; Vascular beta-amyloid; APP
|
||||
| Target Type |
Successful
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Age related macular degeneration [ICD9: 362.5; ICD10: H35.3] | |||||
| Amyloidosis [ICD9: 277.3; ICD10: E85] | |||||
| Brain injury [ICD10: S09.90] | |||||
| Cerebral amyloid angiopathy [ICD10: I68.0] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Diagnostic imaging [ICD9: 331; ICD10: G30, I73.9] | |||||
| Glioma [ICD9: 191; ICD10: C71] | |||||
| Geographic retinal atrophy; Macular degeneration [ICD9:362.5; ICD10: H35.3] | |||||
| Mild to moderate alzheimer disease [ICD9: 331; ICD10: G30] | |||||
| Mild cognitive impairment [ICD9: 331.83; ICD10: F06.7] | |||||
| Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably representsa stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T87024
|
||||
| UniProt ID | |||||
| Sequence |
MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTN IKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Florbetapir F-18 | Drug Info | Approved | Diagnostic imaging | [532210] |
| Bapineuzumab | Drug Info | Phase 3 | Alzheimer disease | [532639], [541974] | |
| BIIB037 | Drug Info | Phase 3 | Alzheimer disease | [525246] | |
| Curcumin | Drug Info | Phase 3 | Cancer | [532348], [542031] | |
| NI-101 | Drug Info | Phase 3 | Alzheimer disease | [525246], [543075] | |
| Solanezumab | Drug Info | Phase 3 | Alzheimer disease | [524370], [541976] | |
| Tramiprosate | Drug Info | Phase 3 | Alzheimer disease | [521823] | |
| CAD-106 | Drug Info | Phase 2/3 | Alzheimer disease | [525332] | |
| AN-1792 | Drug Info | Phase 2 | Alzheimer disease | [521492] | |
| BAN2401 | Drug Info | Phase 2 | Alzheimer disease | [524187] | |
| Crenezumab | Drug Info | Phase 2 | Alzheimer disease | [523453], [541978] | |
| ELND005 | Drug Info | Phase 2 | Mild to moderate alzheimer disease | [524184] | |
| FRM-0962 | Drug Info | Phase 2 | Alzheimer disease | [550787] | |
| GSK933776 | Drug Info | Phase 2 | Geographic retinal atrophy; Macular degeneration | [523450] | |
| GSK933776A | Drug Info | Phase 2 | Alzheimer disease | [548646] | |
| NIC5-15 | Drug Info | Phase 2 | Alzheimer disease | [524412] | |
| Ponezumab | Drug Info | Phase 2 | Alzheimer disease | [524248] | |
| UB-311 | Drug Info | Phase 2 | Alzheimer disease | [525319] | |
| ACI-24 | Drug Info | Phase 1/2 | Alzheimer disease | [548977] | |
| 11C-6-Me-BTA-1 | Drug Info | Phase 1 | Alzheimer disease | [525385] | |
| 11C-AZD-2184 | Drug Info | Phase 1 | Alzheimer disease | [522574] | |
| AAB-003/PF-05236812 | Drug Info | Phase 1 | Alzheimer disease | [523505] | |
| AD-03 | Drug Info | Phase 1 | Alzheimer disease | [549226] | |
| Affitope AD-01 | Drug Info | Phase 1 | Alzheimer disease | [522053] | |
| ALZ-801 | Drug Info | Phase 1 | Alzheimer disease | [549542] | |
| Anti-N3pG-Abeta antibody | Drug Info | Phase 1 | Alzheimer disease | [524268] | |
| DWP-09031 | Drug Info | Phase 1 | Alzheimer disease | [523784] | |
| V-950 | Drug Info | Phase 1 | Alzheimer disease | [548699] | |
| AAB-002 | Drug Info | Phase 0 | Alzheimer disease | [548360] | |
| NN-818 | Drug Info | Preclinical | Brain injury | [547965] | |
| Pepticlere | Drug Info | Preclinical | Alzheimer disease | [548270] | |
| Affitope AD-02 | Drug Info | Discontinued in Phase 2 | Alzheimer disease | [548819] | |
| RN6G | Drug Info | Discontinued in Phase 2 | Age related macular degeneration | [549021] | |
| PF-05236812 | Drug Info | Discontinued in Phase 1 | Alzheimer disease | [548953] | |
| Inhibitor | 1,6-bis(4'-aminophenyl)-hexa-1,3,5-triene | Drug Info | [528161] | ||
| 1,6-bis(4'-dimethylaminophenyl)-hexa-1,3,5-triene | Drug Info | [528161] | |||
| 1,6-Bis(4'-hydroxyphenyl)-hexa-1,3,5-triene | Drug Info | [528161] | |||
| 1,6-bis(4'-methylaminophenyl)-hexa-1,3,5-triene | Drug Info | [528161] | |||
| 1,6-bis(4'-nitrophenyl)-hexa-1,3,5-triene | Drug Info | [528161] | |||
| 2,5-bis(2-methoxyphenyl)thiophene | Drug Info | [527907] | |||
| 2,5-bis(4-Hydroxyphenyl)thiophene | Drug Info | [527907] | |||
| 2,5-bis(4-methoxyphenyl)thiophene | Drug Info | [527907] | |||
| 2,5-bis(4-nitrophenyl)thiophene | Drug Info | [527907] | |||
| 2-(4-(methylamino)phenyl)benzo[d]thiazol-6-ol | Drug Info | [528161] | |||
| 2-(4-nitrophenyl)-5-(4-methoxyphenyl)thiophene | Drug Info | [527907] | |||
| 4-(5-(4-(methylamino)phenyl)thiophen-2-yl)phenol | Drug Info | [527907] | |||
| 4-(5-(4-aminophenyl)thiophen-2-yl)benzenamine | Drug Info | [527907] | |||
| 4-(5-(4-aminophenyl)thiophen-2-yl)phenol | Drug Info | [527907] | |||
| 4-(5-(4-methoxyphenyl)thiophen-2-yl)benzenamine | Drug Info | [527907] | |||
| 4-(5-(4-methoxyphenyl)thiophen-2-yl)phenol | Drug Info | [527907] | |||
| 5-hydroxy-2-(4-aminophenyl)benzofuran | Drug Info | [528159] | |||
| 5-hydroxy-2-(4-dimethylaminophenyl)benzofuran | Drug Info | [528159] | |||
| 5-hydroxy-2-(4-methylaminophenyl)benzofuran | Drug Info | [528159] | |||
| 5-methoxy-2-(4-aminophenyl)benzofuran | Drug Info | [528159] | |||
| 5-methoxy-2-(4-dimethylaminophenyl)benzofuran | Drug Info | [528159] | |||
| 5-methoxy-2-(4-methylaminophenyl)benzofuran | Drug Info | [528159] | |||
| 6-iodo-4'-dimethyaminoflavone | Drug Info | [527855] | |||
| 6-iodo-4'-hydroxyflavone | Drug Info | [527855] | |||
| 6-iodo-4'-methoxyflavone | Drug Info | [527855] | |||
| 6-iodo-4'-methylaminoflavone | Drug Info | [527855] | |||
| A-887755 | Drug Info | [543619] | |||
| Abloid | Drug Info | [543619] | |||
| ACI-636 | Drug Info | [543619] | |||
| ALZ-801 | Drug Info | [550240] | |||
| AN-1792 | Drug Info | [528396] | |||
| ANA-1 | Drug Info | [543619] | |||
| ANA-5 | Drug Info | [543619] | |||
| Anticalin | Drug Info | [543619] | |||
| ARC-069 | Drug Info | [543619] | |||
| ARN-2966 | Drug Info | [543619] | |||
| AZ4800 | Drug Info | [531800] | |||
| Chrysamine -G | Drug Info | [528454] | |||
| CT-003230 | Drug Info | [543619] | |||
| Curcumin | Drug Info | [528454] | |||
| DBT-1339 | Drug Info | [543619] | |||
| DEHYDROZINGERONE | Drug Info | [528454] | |||
| DWP-09031 | Drug Info | [543619] | |||
| ELND-007 | Drug Info | [551654] | |||
| Gamma secretase inhibitors | Drug Info | [543619] | |||
| KMS-88009 | Drug Info | [543619] | |||
| Methionine Sulfoxide | Drug Info | [551374] | |||
| NIC5-15 | Drug Info | [532998] | |||
| Pepticlere | Drug Info | [550355] | |||
| PF-05236812 | Drug Info | [544313] | |||
| RN6G | Drug Info | [544404] | |||
| SB-13 | Drug Info | [528161] | |||
| SEM-606 | Drug Info | [543619] | |||
| SEN-1500 | Drug Info | [543619] | |||
| SP-08 | Drug Info | [543619] | |||
| SR-973 | Drug Info | [528025] | |||
| Systebryl | Drug Info | [543619] | |||
| Turmeric extracts | Drug Info | [543619] | |||
| VK-11 | Drug Info | [543619] | |||
| VK-12 | Drug Info | [543619] | |||
| Modulator | 11C-6-Me-BTA-1 | Drug Info | [529223] | ||
| 123I-DRM-106 | Drug Info | [543619] | |||
| 18F-AV-45 dimer | Drug Info | [543619] | |||
| AAB-002 | Drug Info | [543619] | |||
| AAB-003/PF-05236812 | Drug Info | [543619] | |||
| AS-602704 | Drug Info | ||||
| BAN-2203 | Drug Info | [543619] | |||
| BAN2401 | Drug Info | [532910] | |||
| Beta amyloid lowering agents | Drug Info | [543619] | |||
| BIIB037 | Drug Info | [544313] | |||
| Crenezumab | Drug Info | [543619] | |||
| EDN-OL1 | Drug Info | [543619] | |||
| ELND005 | Drug Info | [531622] | |||
| Florbetapir F-18 | Drug Info | [551871] | |||
| FRM-0962 | Drug Info | [551214] | |||
| Gamma-secretase modulators | Drug Info | [543619] | |||
| GSK933776 | Drug Info | [544153] | |||
| GSK933776A | Drug Info | [544349] | |||
| NN-818 | Drug Info | [543619] | |||
| PA-1637 | Drug Info | [543619] | |||
| Solanezumab | Drug Info | [532638] | |||
| TKP-1001 | Drug Info | [543619] | |||
| UB-311 | Drug Info | [544391] | |||
| Binder | 11C-AZD-2184 | Drug Info | [544299] | ||
| Agonist | CD45RB | Drug Info | [543619] | ||
| Antagonist | Tramiprosate | Drug Info | [528183] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Notch signaling pathway | ||||
| Alzheimer' | |||||
| s disease | |||||
| Reactome | Nuclear signaling by ERBB4 | ||||
| Degradation of the extracellular matrix | |||||
| Regulated proteolysis of p75NTR | |||||
| NRIF signals cell death from the nucleus | |||||
| Activated NOTCH1 Transmits Signal to the Nucleus | |||||
| Constitutive Signaling by NOTCH1 PEST Domain Mutants | |||||
| Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants | |||||
| EPH-ephrin mediated repulsion of cells | |||||
| WikiPathways | Notch Signaling Pathway | ||||
| Signaling by ERBB4 | |||||
| Signaling by NOTCH3 | |||||
| Signaling by NOTCH4 | |||||
| Signaling by NOTCH1 | |||||
| Signaling by NOTCH2 | |||||
| Notch Signaling Pathway | |||||
| Alzheimers Disease | |||||
| Signalling by NGF | |||||
| References | |||||
| Ref 521492 | ClinicalTrials.gov (NCT00021723) Randomized Safety, Tolerability and Pilot Efficacy of AN-1792 in Alzheimer's Disease. U.S. National Institutes of Health. | ||||
| Ref 521823 | ClinicalTrials.gov (NCT00314912) Open-Label Extension of the Phase III Study With Tramiprosate (3APS) in Patients With Mild to Moderate Alzheimer's Disease. U.S. National Institutes of Health. | ||||
| Ref 522053 | ClinicalTrials.gov (NCT00495417) Tolerability and Safety of Subcutaneous Administration of Affitope AD01 in Mild to Moderate Alzheimer's Disease. U.S. National Institutes of Health. | ||||
| Ref 522574 | ClinicalTrials.gov (NCT00838877) Positron Emission Tomography (PET) Study With [18F]AZD4694 and [11C]AZD2184, Candidate PET Ligands for A??Amyloid. U.S. National Institutes of Health. | ||||
| Ref 523450 | ClinicalTrials.gov (NCT01342926) Clinical Study to Investigate Safety and Efficacy of GSK933776 in Adult Patients With Geographic Atrophy Secondary to Age-related Macular Degeneration. U.S. National Institutes of Health. | ||||
| Ref 523453 | ClinicalTrials.gov (NCT01343966) A Study to Evaluate the Efficacy and Safety of MABT5102A in Patients With Mild to Moderate Alzheimer's Disease (ABBY). U.S. National Institutes of Health. | ||||
| Ref 523505 | ClinicalTrials.gov (NCT01369225) Open Label Extension Study Evaluating Safety and Tolerability of AAB-003 (PF-05236812) in Subject With Mild to Moderate Alzheimer's Disease. U.S. National Institutes of Health. | ||||
| Ref 523784 | ClinicalTrials.gov (NCT01522586) Clinical Trial to Investigate the Safety, Tolerability, and Pharmacokinetics of DWP09031. U.S. National Institutes of Health. | ||||
| Ref 524184 | ClinicalTrials.gov (NCT01766336) A 36-Week Safety Extension Study of ELND005 as a Treatment for Agitation and Aggression in Alzheimer's Disease. U.S. National Institutes of Health. | ||||
| Ref 524187 | ClinicalTrials.gov (NCT01767311) A Study to Evaluate Safety, Tolerability, and Efficacy of BAN2401 in Subjects With Early Alzheimer's Disease. U.S. National Institutes of Health. | ||||
| Ref 524248 | ClinicalTrials.gov (NCT01821118) Study Evaluating the Safety,Tolerability and Efficacy of PF-04360365 in Adults With Probable Cerebral Amyloid Angiopathy. U.S. National Institutes of Health. | ||||
| Ref 524268 | ClinicalTrials.gov (NCT01837641) A Study of LY3002813 in Participants With Alzheimer's Disease. U.S. National Institutes of Health. | ||||
| Ref 524370 | ClinicalTrials.gov (NCT01900665) Progress of Mild Alzheimer's Disease in Participants on Solanezumab Versus Placebo. U.S. National Institutes of Health. | ||||
| Ref 524412 | ClinicalTrials.gov (NCT01928420) A Single Site, Randomized, Double-blind, Placebo Controlled Trial of NIC5-15 in Subjects With Alzheimer's Disease. U.S. National Institutes of Health. | ||||
| Ref 525246 | ClinicalTrials.gov (NCT02484547) 221AD302 Phase 3 Study of Aducanumab (BIIB037) in Early Alzheimer's Disease. | ||||
| Ref 525319 | ClinicalTrials.gov (NCT02551809) Evaluate the Safety, Tolerability, Immunogenicity and Efficacy of UB-311 in Mild Alzheimer's Disease (AD) Patients. | ||||
| Ref 525332 | ClinicalTrials.gov (NCT02565511) A Study of CAD106 and CNP520 Versus Placebo in Participants at Risk for the Onset of Clinical Symptoms of Alzheimer's Disease. | ||||
| Ref 525385 | List of drugs in development for neurodegenerative diseases: update October 2011. Neurodegener Dis. 2012;9(4):210-83. | ||||
| Ref 532348 | Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68. | ||||
| Ref 532639 | Two phase 3 trials of bapineuzumab in mild-to-moderate Alzheimer's disease. N Engl J Med. 2014 Jan 23;370(4):322-33. | ||||
| Ref 541974 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6930). | ||||
| Ref 541976 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6932). | ||||
| Ref 541978 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6934). | ||||
| Ref 542031 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7000). | ||||
| Ref 543075 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8325). | ||||
| Ref 547965 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020811) | ||||
| Ref 548270 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023984) | ||||
| Ref 548360 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024936) | ||||
| Ref 548646 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027328) | ||||
| Ref 548699 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027767) | ||||
| Ref 548819 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029150) | ||||
| Ref 548953 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030748) | ||||
| Ref 548977 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031074) | ||||
| Ref 549021 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031573) | ||||
| Ref 549226 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033932) | ||||
| Ref 527855 | J Med Chem. 2005 Nov 17;48(23):7253-60.Radioiodinated flavones for in vivo imaging of beta-amyloid plaques in the brain. | ||||
| Ref 527907 | Bioorg Med Chem Lett. 2006 Mar 1;16(5):1350-2. Epub 2005 Dec 1.Design, synthesis, and structure-activity relationship of novel thiophene derivatives for beta-amyloid plaque imaging. | ||||
| Ref 528025 | Bioorg Med Chem Lett. 2006 May 1;16(9):2357-63. Epub 2006 Feb 10.Synthesis and evaluation of succinoyl-caprolactam gamma-secretase inhibitors. | ||||
| Ref 528159 | J Med Chem. 2006 May 4;49(9):2725-30.Novel benzofuran derivatives for PET imaging of beta-amyloid plaques in Alzheimer's disease brains. | ||||
| Ref 528161 | J Med Chem. 2006 May 4;49(9):2841-4.Synthesis of biphenyltrienes as probes for beta-amyloid plaques. | ||||
| Ref 528183 | Targeting soluble Abeta peptide with Tramiprosate for the treatment of brain amyloidosis. Neurobiol Aging. 2007 Apr;28(4):537-47. Epub 2006 May 3. | ||||
| Ref 528396 | Amyloid-beta peptide remnants in AN-1792-immunized Alzheimer's disease patients: a biochemical analysis. Am J Pathol. 2006 Sep;169(3):1048-63. | ||||
| Ref 528454 | J Med Chem. 2006 Oct 5;49(20):6111-9.Curcumin and dehydrozingerone derivatives: synthesis, radiolabeling, and evaluation for beta-amyloid plaque imaging. | ||||
| Ref 529223 | Radiosynthesis and evaluation of [11C]BTA-1 and [11C]3'-Me-BTA-1 as potential radiotracers for in vivo imaging of beta-amyloid plaques. Nuklearmedizin. 2007;46(6):271-80. | ||||
| Ref 531270 | Bapineuzumab: anti-beta-amyloid monoclonal antibodies for the treatment of Alzheimer's disease. Immunotherapy. 2010 Nov;2(6):767-82. | ||||
| Ref 531529 | The second-generation active Abeta immunotherapy CAD106 reduces amyloid accumulation in APP transgenic mice while minimizing potential side effects. J Neurosci. 2011 Jun 22;31(25):9323-31. | ||||
| Ref 531622 | A phase 2 randomized trial of ELND005, scyllo-inositol, in mild to moderate Alzheimer disease. Neurology. 2011 Sep 27;77(13):1253-62. | ||||
| Ref 531746 | Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease. J Mol Biol. 2012 Aug 24;421(4-5):525-36. | ||||
| Ref 531800 | First and second generation gamma-secretase modulators (GSMs) modulate amyloid-beta (Abeta) peptide production through different mechanisms. J Biol Chem. 2012 Apr 6;287(15):11810-9. | ||||
| Ref 532638 | Phase 3 trials of solanezumab for mild-to-moderate Alzheimer's disease. N Engl J Med. 2014 Jan 23;370(4):311-21. | ||||
| Ref 532655 | Amyloid-based immunotherapy for Alzheimer's disease in the time of prevention trials: the way forward. Expert Rev Clin Immunol. 2014 Mar;10(3):405-19. | ||||
| Ref 532910 | The murine version of BAN2401 (mAb158) selectively reduces amyloid-beta protofibrils in brain and cerebrospinal fluid of tg-ArcSwe mice. J Alzheimers Dis. 2015;43(2):575-88. | ||||
| Ref 532998 | Combating neurodegenerative disease with chemical probes and model systems. Nat Chem Biol. 2014 Nov;10(11):911-20. | ||||
| Ref 535667 | Novel therapeutic approach for the treatment of Alzheimer's disease by peripheral administration of agents with an affinity to beta-amyloid. J Neurosci. 2003 Jan 1;23(1):29-33. | ||||
| Ref 543619 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2402). | ||||
| Ref 544214 | Targeting Beta Amyloid: A Clinical Review of Immunotherapeutic Approaches in Alzheimer's Disease. Int J Alzheimers Dis. 2012; 2012: 628070. | ||||
| Ref 544222 | Alzheimer's Disease and the Amyloid Cascade Hypothesis: A Critical Review. Int J Alzheimers Dis. 2012; 2012: 369808. | ||||
| Ref 544299 | Low background and high contrast PET imaging of amyloid-beta with [11C]AZD2995 and [11C]AZD2184 in Alzheimer's disease patients. Eur J Nucl Med Mol Imaging. 2013 April; 40(4): 580-593. | ||||
| Ref 544313 | Passive anti-amyloid immunotherapy in Alzheimer's disease: What are the most promising targets?. Immun Ageing. 2013; 10: 18. | ||||
| Ref 544349 | Profile of gantenerumab and its potential in the treatment of Alzheimer's disease. Correction in: Drug Des Devel Ther. 2014; 8: 569. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

