Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T93627
|
||||
| Former ID |
TTDI01920
|
||||
| Target Name |
HIV GAG protein
|
||||
| Gene Name |
gag
|
||||
| Synonyms |
CA; Gag polyprotein; MA; NC; Pr55Gag; p6gag; gag
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | HIV-1 infection [ICD9: 001-139, 042; ICD10: B20-B24] | ||||
| Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
| Function |
p6-gag: Plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1.
|
||||
| UniProt ID | |||||
| Sequence |
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQI
LGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAA DTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGAT PQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTT STLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRF YKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKA RVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEG HQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRSGVETTTPPQKQEPID KELYPLTSLRSLFGNDPSSQ |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Bevirimat | Drug Info | Phase 2 | Human immunodeficiency virus infection | [522771] |
| LIPO-5 | Drug Info | Phase 2 | Human immunodeficiency virus infection | [523727] | |
| Ad35-GRIN | Drug Info | Phase 1/2 | Human immunodeficiency virus infection | [524697] | |
| Ad35-GRIN/ENV | Drug Info | Phase 1 | Human immunodeficiency virus infection | [523741] | |
| RVSVIN HIV-1 gag vaccine | Drug Info | Phase 1 | Human immunodeficiency virus infection | [549955] | |
| TBC-M4 | Drug Info | Phase 1 | Human immunodeficiency virus infection | [522665] | |
| GSK-732461 | Drug Info | Discontinued in Phase 2 | Human immunodeficiency virus infection | [548656] | |
| Gem 92 | Drug Info | Discontinued in Phase 1 | HIV-1 infection | [546454] | |
| PA-1050040 | Drug Info | Discontinued in Phase 1 | Human immunodeficiency virus infection | [548420] | |
| MPI-461359 | Drug Info | Terminated | Human immunodeficiency virus infection | [548769] | |
| Pathways | |||||
| Reactome | Uncoating of the HIV Virion | ||||
| Budding and maturation of HIV virion | |||||
| Integration of provirus | |||||
| Early Phase of HIV Life Cycle | |||||
| Minus-strand DNA synthesis | |||||
| Plus-strand DNA synthesis | |||||
| 2-LTR circle formation | |||||
| Binding and entry of HIV virion | |||||
| Membrane binding and targetting of GAG proteins | |||||
| Assembly Of The HIV Virion | |||||
| Integration of viral DNA into host genomic DNA | |||||
| Autointegration results in viral DNA circles | |||||
| APOBEC3G mediated resistance to HIV-1 infection | |||||
| Vpr-mediated nuclear import of PICs | |||||
| WikiPathways | Host Interactions of HIV factors | ||||
| HIV Life Cycle | |||||
| References | |||||
| Ref 522665 | ClinicalTrials.gov (NCT00902824) Safety and Immunogenicity of TBC-M4, a MVA HIV Vaccine Alone or in a Prime-Boost Regimen With ADVAX DNA HIV Vaccine. U.S. National Institutes of Health. | ||||
| Ref 522771 | ClinicalTrials.gov (NCT00967187) Safety and Efficacy Study of MPC-4326 for Treatment of Patients With HIV-1 Infection.. U.S. National Institutes of Health. | ||||
| Ref 523727 | ClinicalTrials.gov (NCT01492985) Lipopeptide Immunisation With GTU-multiHIV Trial. U.S. National Institutes of Health. | ||||
| Ref 523741 | ClinicalTrials.gov (NCT01496989) Safety and Immunogenicity Study of HIV-MAG Vaccine +/- IL-12 and Ad35-GRIN/ENV in HIV-uninfected Volunteers. U.S. National Institutes of Health. | ||||
| Ref 524697 | ClinicalTrials.gov (NCT02099994) Safety & Immunogenicity of HIV Vaccines in Healthy Kenyan Adults. U.S. National Institutes of Health. | ||||
| Ref 546454 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008217) | ||||
| Ref 548420 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025464) | ||||
| Ref 548656 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027409) | ||||
| Ref 530544 | A Phase 1 study to evaluate the safety and immunogenicity of a recombinant HIV type 1 subtype C-modified vaccinia Ankara virus vaccine candidate in Indian volunteers. AIDS Res Hum Retroviruses. 2009 Nov;25(11):1107-16. | ||||
| Ref 531652 | Recombinant vesicular stomatitis virus-based vaccines against Ebola and Marburg virus infections. J Infect Dis. 2011 Nov;204 Suppl 3:S1075-81. | ||||
| Ref 531993 | Human Immunodeficiency Virus Gag and protease: partners in resistance. Retrovirology. 2012 Aug 6;9:63. | ||||
| Ref 531994 | A phase I double blind, placebo-controlled, randomized study of a multigenic HIV-1 adenovirus subtype 35 vector vaccine in healthy uninfected adults. PLoS One. 2012;7(8):e41936. | ||||
| Ref 532230 | Synthesis and biological evaluation of a new derivative of bevirimat that targets the Gag CA-SP1 cleavage site. Eur J Med Chem. 2013 Apr;62:453-65. | ||||
| Ref 533201 | HIV specific responses induced in nonhuman primates with ANRS HIV-Lipo-5 vaccine combined with rMVA-HIV prime or boost immunizations. Vaccine. 2015 May 11;33(20):2354-9. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

