Target General Infomation
Target ID
T95371
Former ID
TTDNC00373
Target Name
IFN-alphaR
Gene Name
IFNAR1
Synonyms
CRF21; Cytokine receptor classII member 1; Cytokine receptor family 2 member 1; IFNR1; IFNalpha/beta receptor 1; Interferon alpha/beta receptor 1; Type I interferon receptor 1; IFNAR1
Target Type
Clinical Trial
Disease HCV infection [ICD9: 070.4, 070.5, 070.70; ICD10: B17.1, B18.2]
HBV infection [ICD9: 070.2-070.3; ICD10: B16, B18.0, B18.1]
Ovarian cancer [ICD9: 183; ICD10: C56]
Function
Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta- subunits themselves. .
BioChemical Class
Type II cytokine receptor
UniProt ID
Sequence
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF
TPFRKAQIGPPEVHLEAEDKAIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERI
ENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQ
NQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQK
GIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTP
VIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV
FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDE
YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSN
EDESESKTSEELQQDFV
Drugs and Mode of Action
Drug(s) EMZ701 Drug Info Phase 2 HBV infection [551742]
MEDI-546 Drug Info Phase 2 Ovarian cancer [533114], [543016]
R-IFN-1a Drug Info Phase 2 HCV infection [534317]
Zadaxin/lamivudine Drug Info Phase 2 HBV infection [549869]
Belerofon Drug Info Phase 1 HCV infection [551542]
Omega interferon Drug Info Discontinued in Phase 2 HCV infection [545956]
BLX-883 Drug Info Discontinued in Phase 1 HCV infection [548100]
Modulator Belerofon Drug Info [550137]
BLX-883 Drug Info [550866]
Ceplene/Peg-Intron/Rebetol Drug Info [531836]
EMZ701 Drug Info [550880]
MEDI-546 Drug Info [533114]
Omega interferon Drug Info [534496]
R-IFN-1a Drug Info [525616]
Zadaxin/lamivudine Drug Info [527615]
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
NetPath Pathway TCR Signaling Pathway
Leptin Signaling Pathway
PANTHER Pathway Inflammation mediated by chemokine and cytokine signaling pathway
Pathway Interaction Database Downstream signaling in na&amp
#xef
ve CD8+ T cells
Reactome Interferon alpha/beta signaling
Regulation of IFNA signaling
WikiPathways Toll-like receptor signaling pathway
Interferon type I signaling pathways
Interferon alpha/beta signaling
Regulation of toll-like receptor signaling pathway
Osteoclast Signaling
References
Ref 533114Molecular basis for antagonistic activity of anifrolumab, an anti-interferon-alpha receptor 1 antibody. MAbs. 2015;7(2):428-39.
Ref 534317A phase II study of recombinant interferon-beta (r-hIFN-beta 1a) in combination with 5-fluorouracil (5-FU) in the treatment of patients with advanced colorectal carcinoma. Br J Cancer. 1997;75(3):423-6.
Ref 543016(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8258).
Ref 545956Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005492)
Ref 548100Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021901)
Ref 549869Clinical pipeline report, company report or official report of SciClone.
Ref 551542Nautilus Biotech Receives FDA Approval for Phase 1 Clinical Trial in the USA for Oral Belerofon(R), its Long-Lasting, Interferon-Alpha Drug. Nautilus Biotech. MAY 14, 2007.
Ref 551742Clinical pipeline report, company report or official report of Transition Therapeutics.
Ref 525616Further study on the specificity and incidence of neutralizing antibodies to interferon (IFN) in relapsing remitting multiple sclerosis patients treated with IFN beta-1a or IFN beta-1b. J Neurol Sci.1999 Oct 15;168(2):131-6.
Ref 527615Zadaxin (thymosin alpha1) for the treatment of viral hepatitis. Expert Opin Investig Drugs. 1999 Mar;8(3):281-7.
Ref 531836Resistance to mericitabine, a nucleoside analogue inhibitor of HCV RNA-dependent RNA polymerase. Antivir Ther. 2012;17(3):411-23.
Ref 533114Molecular basis for antagonistic activity of anifrolumab, an anti-interferon-alpha receptor 1 antibody. MAbs. 2015;7(2):428-39.
Ref 534496Human interferon omega--a review. Mult Scler. 1995;1 Suppl 1:S44-7.
Ref 550137WO patent application no. 2009,0153,36, Controlled release interferon drug products and treatment of hcv infection using same.
Ref 550866Patent CN103536906 A.
Ref 550880Patent EP2766021 A1.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.