Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1057) | |||||
---|---|---|---|---|---|
DME Name | Catechol-2,3-dioxygenase (caD), Bacillus pumilus | ||||
Synonyms | Catechol dioxygenase; Catechol 2,3-dioxygenase; caD; cado; DZB84_00060 | ||||
Gene Name | DZB84_00060 | ||||
UniProt ID | |||||
EC Number | EC: 1.13.11.2 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Bacillus pumilus (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MSNFDVAQLAHVELYSPKPEETLKFFTDYLGLQISAREGQSVYLRAYEDFYHHTLKITEA
KEAGMAHTAWRASSEAALYQRVQSLEKSGYGKGWIEGDLGHGAAYQFQTPDGHNMEILWN VEYYRAPEDQKTMLKSRPQKRPNIGIPARRLDHINLMCGNVTQNKQFMADELGFKLRENI IMNDGAEMGAWMSVSPLVHEIALMGDQSGEKGRFHHVAYWYGYPQHLMDLADLLVENGIE IEAGPGKHGISQAYFMYVFEPGGNRVELFGDSGYLILDPDWKTITWKEEELDKGIIWYGS PLPQEYFIYGTPDRSSVKVK |
||||
Function | This enzyme initiates the meta-cleavage pathway of catechol degradation and requires FeII. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Gemfibrozil |
Drug Info | Approved | Hypertriglyceridaemia | ICD11: 5C80 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Genomic, proteomic, and metabolite characterization of gemfibrozil-degrading organism Bacillus sp. GeD10. Environ Sci Technol. 2016 Jan 19;50(2):744-55. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.