Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1106) | |||||
---|---|---|---|---|---|
DME Name | Arylamine N-acetyltransferase (NAT), Klebsiella pneumoniae | ||||
Synonyms | N-hydroxyarylamine O-acetyltransferase; nhoA; nhoA_1; SAMEA1713070_01652 | ||||
Gene Name | nhoA_1 | ||||
UniProt ID | |||||
EC Number | EC: 2.3.1.5 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Klebsiella pneumoniae (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MSPFLRAYFSRLGWTGEPDVSIDTLRQLHLQHNSAIPFENLDVLLPREIHLDDLALEAKL
IAGRRGGYCFEQNGLLERALREIGFNVRSLLGRVVLANPPQMPPRTHRLLLVEVAGERWI ADVGFGGQTLTAPIKLLADIPQQTPHGSYRLVHEGDEWTLQFNHHEHWQSMYHFDLGRQY ASDYVMGNFWSAHWPQSHFRHHLLMCRHLPDGGKMTLTNFHFTHWENNHVVEKVDFADVS ALYEGLQTRFGLGVDDPKHGFSEAALAAVMAAFDTHPEAGK |
||||
Function | This enzyme is wide specificity for aromatic amines, including serotonin and it also catalyses acetyl-transfer between arylamines without CoA. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Asacolitin |
Drug Info | Investigative | Inflammatory bowel disease | ICD11: DD72 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.