Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1153) | |||||
---|---|---|---|---|---|
DME Name | Histidine decarboxylase (hdcA), Lactobacillus reuteri | ||||
Synonyms | Histidine decarboxylase proenzyme; hdcA; HDC; DKZ26_01060 | ||||
Gene Name | hdcA | ||||
UniProt ID | |||||
EC Number | EC: 4.1.1.22 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Lactobacillus reuteri (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MSELDTKLHKLGVDRIAISPYKQWSRGYMEPGNIGNGYVTGLKVDAGVRDKTDDEVLDGI
VSYDRAETKNAYIGQINMTTASSFTGPQGHCIGYDLLRNPEVDTAEPLFTVKQWDGSELP IYDAKPLQDSLVEYFGTNNNRRHYPAPGSFIVCANKGVTAERPMNDSDMKPGQGYGVWSA IALSFAKDPAKDSSMFIEDAGVWETPNEDELIEYLKGRRKAIAKSIAECGQDANTSFKGS WIGFAHAMMEPGQIGNAITVAPYISMPVDSIPGGSILTPDTDMDIMENLTMPEWLDKMEY KSLTANGAIKY |
||||
Function | This enzyme catalyzes the decarboxylation of histidine to form histamine. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
L-histidine |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.