Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1171) | |||||
---|---|---|---|---|---|
DME Name | D-psicose 3-epimerase (DPEase), Ruminiclostridium cellulolyticum | ||||
Synonyms | Psicose 3-epimerase; D-psicose-epimerase; Psicose epimerase; DPEase; Ccel_0941; dpe | ||||
Gene Name | DPEase | ||||
UniProt ID | |||||
EC Number | EC: 5.1.3.30 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Ruminiclostridium cellulolyticum (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKHGIYYAYWEQEWEADYKYYIEKVAKLGFDILEIAASPLPFYSDIQINELKACAHGNGI
TLTVGHGPSAEQNLSSPDPDIRKNAKAFYTDLLKRLYKLDVHLIGGALYSYWPIDYTKTI DKKGDWERSVESVREVAKVAEACGVDFCLEVLNRFENYLINTAQEGVDFVKQVDHNNVKV MLDTFHMNIEEDSIGGAIRTAGSYLGHLHTGECNRKVPGRGRIPWVEIGEALADIGYNGS VVMEPFVRMGGTVGSNIKVWRDISNGADEKMLDREAQAALDFSRYVLECHKHS |
||||
Structure | |||||
Function | This enzyme catalyzes the reversible epimerization of D-fructose at the C3 position to yield D-psicose and it is highly specific for D-psicose and shows very low activity with D-tagatose. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
D-fructose |
Drug Info | Investigative | Functional nausea/vomiting | ICD11: DD90 | [1], [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.