Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1172) | |||||
---|---|---|---|---|---|
DME Name | Aminoglycoside N-acetyltransferase (aacC2), Acinetobacter baumannii | ||||
Synonyms | Aminoglycoside N(6')-acetyltransferase type 1; Aminoglycoside resistance protein; AAC(6')-Ih | ||||
Gene Name | aacC2 | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 2.3.1.82 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Acinetobacter baumannii (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human lung. | ||||
Sequence |
MNIMPISESQLSDWLALRCLLWPDHEDVHLQEMRQLITQAHRLQLLAYTDTQQAIAMLEA
SIRYEYVNGTQTSPVAFLEGIFVLPEYRRSGIATGLVQQVEIWAKQFACTEFASDAALDN QISHAMHQALGFHETERVVYFKKNIG |
||||
Structure | |||||
Function | This enzyme catalyzes the transfer of an acetyl group from acetyl-CoA to the 6'-amino group of aminoglycoside molecules conferring resistance to antibiotics containing the purpurosamine ring including amikacin, kanamycin, tobramycin and netilmicin. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 3 Drugs | ||||
Neomycin |
Drug Info | Approved | Hepatic encephalopathy | ICD11: DB99 | [1] |
Netilmicin |
Drug Info | Approved | Acute upper respiratory infection | ICD11: CA07 | [1] |
Tobramycin |
Drug Info | Approved | Conjunctivitis | ICD11: 9A60 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Relationship between antimicrobial resistance and aminoglycoside-modifying enzyme gene expressions in Acinetobacter baumannii. Chin Med J (Engl). 2005 Jan 20;118(2):141-5. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.