Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1206) | |||||
---|---|---|---|---|---|
DME Name | Beta-glucosidase (bglA), Fusobacterium mortiferum | ||||
Synonyms | Periplasmic beta-glucosidase; Glucan endo-1 3-beta-D-glucosidase; Beta-D-glucosidase; Beta-glucosidase-related glycosidases; BN791_01499 | ||||
Gene Name | BN791_01499 | ||||
UniProt ID | |||||
EC Number | EC: 3.2.1.21 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Fusobacterium mortiferum (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MSVTLKEKLYQMFILGTDGGYYKELLKEGLGGIIFFSKDIQTKTQFKSLIDDIKLISKIP
PFLSIDQEGGRVERTENIHNGKKYLSAKFAFEKGEKFLKSQTEEISKELKSYGINLNFAP CIDTNTNPNNPIIGVRAFSSNPDEVIKAEKIVSKTYEENGIIPCVKHFPGHGDANADSHL TLPKIDLSLKDMEETHIKPFKSAIENGIDMVMVAHLFCTCFEKEEVPTSLSKNAIDYLRN NLNFDKVAISDDMVMKGVAKFGDVEACEMGIKAGLNLFIYRFSDEKTSNIIQEIYKKAQK DNLLKEKIENSYNKIMALKSKYNIA |
||||
Function | This enzyme has wide specificity for beta-D-glucosides such as beta-D-galactosides, alpha-L-arabinosides, beta-D-xylosides, beta-D-fucosides. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 3 Drugs | ||||
Ginsenoside Rb1 |
Drug Info | Investigative | Obesity | ICD11: 5B81 | [1] |
Gypenoside XVII |
Drug Info | Investigative | Arteriosclerosis obliterans | ICD11: BD40 | [1] |
Glucopyranosyl oleanolate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
References | |||||
---|---|---|---|---|---|
1 | Constitutive beta-glucosidases hydrolyzing ginsenoside Rb1 and Rb2 from human intestinal bacteria. Biol Pharm Bull. 2000 Dec;23(12):1481-5. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.