Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1223)
DME Name Beta-lactamase (blaB), Escherichia coli
Synonyms Penicillinase; Cephalosporinase; Beta-lactam; Beta-lactamase TEM; IRT-4; TEM-1; TEM-16/CAZ-7; TEM-2; TEM-24/CAZ-6; TEM-3; TEM-4; TEM-5; TEM-6; TEM-8/CAZ-2; and; bla; blaT-3; blaT-4; blaT-5; blaT-6
Gene Name bla
UniProt ID
BLAT_ECOLX
Gene ID
10076131
EC Number    EC: 3.5.2.6     (Click to Show/Hide the Complete EC Tree)
Hydrolases
Carbon-nitrogen hydrolase
Cyclic amide hydrolase
EC: 3.5.2.6
Lineage    Species: Escherichia coli     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Structure
1AXB ; 1BT5 ; 1BTL ; 1CK3 ; 1ERM ; 1ERO ; 1ERQ ; 1ESU ; 1FQG ; 1JTD ; 1JTG ; A/C=24-286 ; 1JVJ ; 1JWP ; 1LI0 ; 1LI9 ; 1M40 ; 1NXY ; 1NY0 ; 1NYM ; 1NYY ; 1PZO ; 1PZP ; 1S0W ; 1TEM ; 1XPB ; 1XXM ; 1YT4 ; 1ZG4 ; 1ZG6 ; 2B5R ; 2V1Z ; 2V20 ; 3C7U ; 3C7V ; 3CMZ ; 3DTM ; 3JYI ; 3TOI ; 4DXB ; 4DXC ; 4GKU ; 4IBR ; 4IBX ; 4ID4 ; 4MEZ ; 4QY5 ; 4QY6 ; 4R4R ; 4R4S ; 4RVA ; 4RX2 ; 4RX3 ; 4ZJ1 ; 4ZJ2 ; 4ZJ3 ; 5HVI ; 5HW1 ; 5HW5 ; 5I52 ; 5I63 ; 5IQ8 ; 5KKF ; 5KPU ; 5NPO ; 6APA ; 6AYK ; 6B2N
Function This enzyme is the most prevalent beta-lactamase in enterobacteria. It hydrolyzes the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          4 Drugs
Cefotaxime
 Drug Info Approved Meningitis ICD11: 1A62 [1]
Cefotaxime
 Drug Info Approved Meningitis ICD11: 1A62 [2]
Cefoxitin
 Drug Info Approved Peritonitis ICD11: DC50 [1]
Ertapenem
 Drug Info Approved Pneumocystis pneumonia ICD11: CA40 [3]
      Drugs in Phase 4 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
Cefpirome
 Drug Info Phase 4 Pseudomonas infection ICD11: 1G40 [1]
References
1 Oral streptococcal strains isolated from odontogenic infections and their susceptibility to antibiotics. Rev Med Chir Soc Med Nat Iasi. 2006 Oct-Dec;110(4):1012-5.
2 Single amino acid substitution between SHV-1 beta-lactamase and cefotaxime-hydrolyzing SHV-2 enzyme
3 War wound treatment complications due to transfer of an IncN plasmid harboring bla(OXA-181) from Morganella morganii to CTX-M-27-producing sequence type 131 Escherichia coli. Antimicrob Agents Chemother. 2015;59(6):3556-62.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.