Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1226) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase (blaB), Klebsiella oxytoca | ||||
Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; Beta-lactamase OXY-1; bla | ||||
Gene Name | bla | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Klebsiella oxytoca (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human skin. | ||||
Sequence |
MLKSSWRKTALMAAAAVPLLLASGSLWASADAIQQKLADLEKRSGGRLGVALINTADDSQ
TLYRGDERFAMCSTGKVMAAAAVLKQSESNPEVVNKRLEIKKSDLVVWSPITEKHLQSGM TLAELSAAALQYSDNTAMNKMISYLGGPEKVTAFAQSIGDVTFRLDRTEPALNSAIPGDK RDTTTPLAMAESLRKLTLGNALGEQQRAQLVTWLKGNTTGGQSIRAGLPASWAVGDKTGA GDYGTTNDIAVIWPENHAPLVLVTYFTQPQQDAKSRKEVLAAAAKIVTEGL |
||||
Structure | |||||
Function | This enzyme hydrolyzes broad-spectrum beta-lactam antibiotics and is active against cephalosporins. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Piperacillin |
Drug Info | Approved | Pneumocystis pneumonia | ICD11: CA40 | [1] |
Tazobactam |
Drug Info | Approved | Pseudomonas infection | ICD11: 1G40 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Characterization of piperacillin/tazobactam-resistant klebsiella oxytoca recovered from a nosocomial outbreak. PLoS One. 2015 Nov 5;10(11):e0142366. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.