Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1236) | |||||
---|---|---|---|---|---|
DME Name | Cytochrome P450 BM3 (cypBM3), Bacillus megaterium | ||||
Synonyms | Cytochrome P450 family 102 subfamily A member 3; Cytochrome cypBM3; P450 BM3; cypBM3 | ||||
Gene Name | cypBM3 | ||||
UniProt ID | |||||
EC Number | EC: 1.14.14.1 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Bacillus megaterium (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
DKPVQLGCKFADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFA
GDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNADEHIEVP EDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENK RQFQDDIKVMNDLVDKIIADRKASGEQSDDLLTHYAKRKDPETGEPLDDENIRYQIITFL IAGHETT |
||||
Function | This enzyme is P-450 heme-thiolate protein, acting on a wide range of substrates including many xenobiotics, steroids, fatty acids, vitamins and prostaglandins; reactions catalysed include hydroxylation, epoxidation, N-oxidation, sulfooxidation, N-, S- and O-dealkylations, desulfation, deamination, and reduction of azo, nitro and N-oxide groups. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Discontinued/withdrawn Drugs | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
HY-12638 |
Drug Info | Discontinued | Tapeworm infestation | ICD11: 1F7Y | [1] |
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Chlorpyrifos |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
Dinoterb |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
References | |||||
---|---|---|---|---|---|
1 | PEGylation of cytochrome P450 enhances its biocatalytic performance for pesticide transformation. Int J Biol Macromol. 2017 Dec;105(Pt 1):163-170. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.