Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1331) | |||||
---|---|---|---|---|---|
DME Name | Nitroreductase (NTR), Clostridium sporogenes | ||||
Synonyms | FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; NCTC13020_02816; nfrA2_4 | ||||
Gene Name | nfrA2_4 | ||||
UniProt ID | |||||
EC Number | EC: 1.5.1.39 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Clostridium sporogenes (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MNAILKRRSIRKYKDKKISDDIVEELLRAGMAAPSAVNEQPWQFIVLRDKETMKKITKVH
EYSKMLLEADVAIVVCGDKSKELVDDFWVQDCSAATENILIEAQDKGLGAVWLGVYPIKE RVDGIKEILNLPEGITPLSVIPIGYPDEKKEPADRSNKERVHYDKW |
||||
Function | This enzyme contains FMN and can utilize NADH and NADPH with similar reaction rates. It also reduces riboflavin and FAD, but more slowly. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Nitrofurantoin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1], [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.