Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1473) | |||||
---|---|---|---|---|---|
DME Name | Azoreductase (azoR), Bacteroides fragilis | ||||
Synonyms | Azo-dye reductase; FMN-dependent NADH-azo compound oxidoreductase; FMN-dependent NADH-azoreductase; azoR; BSIG_4687; Btheta7330_01816 | ||||
Gene Name | azoR | ||||
UniProt ID | |||||
EC Number | EC: 1.7.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Bacteroides fragilis (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MDRKGFLKSTMIATGSLLLGGAGICRFLNDKEPADGPFPRTIEKIHCGNMKKVLVIMSAG
TKLGNTDRLTDAYIKGLVERGHSVTKVYLGSMRIEGCRGCGVCQRLAHQCAVRDGMQDIY PLFAECDTVVMASPLYFWTITSQLKAFIDRLYAISADDKYPQKDTVLLMTAGDDNENTFD QPKQYFRLLSQALGWNEVGIYCAGGCTGCEKLARQIDKVHLENVYKMGLEL |
||||
Function | This enzyme catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Sulfasalazine |
Drug Info | Approved | Rheumatoid arthritis | ICD11: FA20 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Mapping human microbiome drug metabolism by gut bacteria and their genes. Nature. 2019 Jun;570(7762):462-467. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.